User:Michael Strong/H1N1/HA

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

Protein Structural Homolgy Model

HA Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 HA, residues 16-341, 83% sequence identity to pdp template 3gbn

Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
HA V7I 237624327_A/swine/Alberta/O 1
HA L8M 227831776_A/California/06/2 5
HA A13T 229536010_A/Kansas/03/2009 1
HA N48D 229536049_A/Arizona/02/2009 1
HA L49I 229535997_A/South_Carolina/ 2
HA I96V 229598877_A/Ohio/07/2009 1
HA S100P 229535949_A/California/04/2 5
HA N104K 229892708_A/Canada-AB/RV153 1
HA V125M 229598896_A/Texas/15/2009 2
HA V149I 229536088_A/Indiana/09/2009 1
HA A214T 229535949_A/California/04/2 2
HA Y215N 237624327_A/swine/Alberta/O 1
HA S220T 229396494_A/Ohio/07/2009 21
HA F227L 229598896_A/Texas/15/2009 1
HA D239G 229892706A/Mexico/InDRE4114 1
HA D291E 229535997_A/South_Carolina/ 2
HA N293D 229783398_A/New_York/1682/2 1
HA V338I 229535949_A/California/04/2 5
HA A351V 237624327_A/swine/Alberta/O 1
HA I400V 229484027_A/Canada-NS/RV153 3
HA V428I 229598877_A/Ohio/07/2009 4
HA V444I 237511819_A/Mexico/4108/200 1
HA I527F 229892706A/Mexico/InDRE4114 1

Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of HA Protein, 68 sequences

gi|229396357_A/New_York/12/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892708_A/Canada-AB/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396399_A/New_York/18/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536064_A/New_York/20/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536055_A/New_York/20/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396487_A/New_York/19/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227977099_A/New_York/19/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396410_A/New_York/31/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396419_A/New_York/23/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396381_A/New_York/11/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396443_A/New_York/10/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229484031_A/Canada-ON/RV152      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535797_A/New_York/22/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536129_A/New_York/13/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536100_A/Massachusetts/0      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535909_A/Massachusetts/0      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535834_A/California/14/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892704_A/Canada-ON/RV152      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229598877_A/Ohio/07/2009         MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396504_A/Ohio/07/2009         MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396494_A/Ohio/07/2009         MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892702_A/Canada-ON/RV152      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229783398_A/New_York/1682/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511819_A/Mexico/4108/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536049_A/Arizona/02/2009      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVDLL 50
gi|229536088_A/Indiana/09/2009      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229484027_A/Canada-NS/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892700_A/Canada-NS/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892710_A/Canada-NS/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511821_A/Mexico/4115/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511811_A/Mexico/4482/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511799_A/Mexico/4486/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511817_A/Mexico/4603/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511795_A/Mexico/4604/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229783367_A/Korea/01/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229783377_A/New_York/1669/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536022_A/Arizona/01/2009      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536003_A/Kansas/02/2009       MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536121_A/Michigan/02/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229598896_A/Texas/15/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229609563_A/Catalonia/P154/      -------------------------ANNSTDTVDTVLEKNVTVTHSVNLL 25
gi|229299521_A/Texas/04/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228860929_A/Netherlands/602      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229484029_A/Mexico/InDRE448      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535997_A/South_Carolina/      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNIL 50
gi|229609557_A/Catalonia/P148/      ------------------------HANNSTDTVDTVLEKNVTVTHSVNIL 26
gi|229299515_A/Texas/04/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396467_A/Texas/06/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535816_A/Texas/09/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535985_A/Texas/08/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536075_A/Texas/07/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229368677_A/Denmark/513/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831826_A/Texas/04/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831774_A/Texas/05/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831776_A/California/06/2      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831759_A/California/05/2      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227977104_A/California/10/2      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536135_A/Colorado/03/200      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228481046_A/Auckland/1/2009      ------------------------------------------VTHSVNLL 8
gi|237624327_A/swine/Alberta/O      MKAILVIMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536010_A/Kansas/03/2009       MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228495370_A/Regensburg/Germ      ----------------------------------------VTVTHSVNLL 10
gi|229892706A/Mexico/InDRE4114      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535949_A/California/04/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227809830_A/California/04/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229299517_A/California/07/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228017758_A/California/08/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227977172_A/California/07/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
                                                                              *****::*

gi|229396357_A/New_York/12/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892708_A/Canada-AB/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396399_A/New_York/18/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536064_A/New_York/20/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536055_A/New_York/20/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396487_A/New_York/19/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227977099_A/New_York/19/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396410_A/New_York/31/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396419_A/New_York/23/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396381_A/New_York/11/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396443_A/New_York/10/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229484031_A/Canada-ON/RV152      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535797_A/New_York/22/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536129_A/New_York/13/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536100_A/Massachusetts/0      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535909_A/Massachusetts/0      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535834_A/California/14/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892704_A/Canada-ON/RV152      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229598877_A/Ohio/07/2009         EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYVVETS 100
gi|229396504_A/Ohio/07/2009         EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396494_A/Ohio/07/2009         EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892702_A/Canada-ON/RV152      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229783398_A/New_York/1682/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511819_A/Mexico/4108/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536049_A/Arizona/02/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536088_A/Indiana/09/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229484027_A/Canada-NS/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892700_A/Canada-NS/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892710_A/Canada-NS/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511821_A/Mexico/4115/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511811_A/Mexico/4482/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511799_A/Mexico/4486/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511817_A/Mexico/4603/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511795_A/Mexico/4604/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229783367_A/Korea/01/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229783377_A/New_York/1669/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536022_A/Arizona/01/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536003_A/Kansas/02/2009       EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536121_A/Michigan/02/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229598896_A/Texas/15/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229609563_A/Catalonia/P154/      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 75
gi|229299521_A/Texas/04/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|228860929_A/Netherlands/602      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229484029_A/Mexico/InDRE448      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535997_A/South_Carolina/      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229609557_A/Catalonia/P148/      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 76
gi|229299515_A/Texas/04/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396467_A/Texas/06/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535816_A/Texas/09/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535985_A/Texas/08/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536075_A/Texas/07/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229368677_A/Denmark/513/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831826_A/Texas/04/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831774_A/Texas/05/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831776_A/California/06/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831759_A/California/05/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227977104_A/California/10/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536135_A/Colorado/03/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|228481046_A/Auckland/1/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 58
gi|237624327_A/swine/Alberta/O      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536010_A/Kansas/03/2009       EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|228495370_A/Regensburg/Germ      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 60
gi|229892706A/Mexico/InDRE4114      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535949_A/California/04/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|227809830_A/California/04/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|229299517_A/California/07/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|228017758_A/California/08/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|227977172_A/California/07/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
                                    *********************************************:***.

gi|229396357_A/New_York/12/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892708_A/Canada-AB/RV153      SSDKGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396399_A/New_York/18/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536064_A/New_York/20/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536055_A/New_York/20/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396487_A/New_York/19/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227977099_A/New_York/19/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396410_A/New_York/31/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396419_A/New_York/23/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396381_A/New_York/11/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396443_A/New_York/10/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229484031_A/Canada-ON/RV152      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535797_A/New_York/22/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536129_A/New_York/13/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536100_A/Massachusetts/0      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535909_A/Massachusetts/0      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535834_A/California/14/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892704_A/Canada-ON/RV152      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229598877_A/Ohio/07/2009         SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHXSNKGVT 150
gi|229396504_A/Ohio/07/2009         SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396494_A/Ohio/07/2009         SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892702_A/Canada-ON/RV152      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229783398_A/New_York/1682/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511819_A/Mexico/4108/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536049_A/Arizona/02/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536088_A/Indiana/09/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGIT 150
gi|229484027_A/Canada-NS/RV153      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892700_A/Canada-NS/RV153      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892710_A/Canada-NS/RV153      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511821_A/Mexico/4115/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511811_A/Mexico/4482/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511799_A/Mexico/4486/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511817_A/Mexico/4603/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511795_A/Mexico/4604/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229783367_A/Korea/01/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229783377_A/New_York/1669/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536022_A/Arizona/01/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536003_A/Kansas/02/2009       SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536121_A/Michigan/02/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229598896_A/Texas/15/2009        SSDNGTCYPGDFIDYEELREQLSSMSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229609563_A/Catalonia/P154/      SSDNGTCYPGDFIDYEELREQLSSMSSFERFEIFPKTSSWPNHDSNKGVT 125
gi|229299521_A/Texas/04/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228860929_A/Netherlands/602      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229484029_A/Mexico/InDRE448      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535997_A/South_Carolina/      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229609557_A/Catalonia/P148/      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 126
gi|229299515_A/Texas/04/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396467_A/Texas/06/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535816_A/Texas/09/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535985_A/Texas/08/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536075_A/Texas/07/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229368677_A/Denmark/513/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831826_A/Texas/04/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831774_A/Texas/05/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831776_A/California/06/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831759_A/California/05/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227977104_A/California/10/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536135_A/Colorado/03/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228481046_A/Auckland/1/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 108
gi|237624327_A/swine/Alberta/O      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536010_A/Kansas/03/2009       SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228495370_A/Regensburg/Germ      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 110
gi|229892706A/Mexico/InDRE4114      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535949_A/California/04/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227809830_A/California/04/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229299517_A/California/07/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228017758_A/California/08/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227977172_A/California/07/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
                                    ***:********************:****************** ****:*

gi|229396357_A/New_York/12/200      XACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892708_A/Canada-AB/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396399_A/New_York/18/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536064_A/New_York/20/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536055_A/New_York/20/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396487_A/New_York/19/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227977099_A/New_York/19/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396410_A/New_York/31/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396419_A/New_York/23/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396381_A/New_York/11/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396443_A/New_York/10/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229484031_A/Canada-ON/RV152      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535797_A/New_York/22/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536129_A/New_York/13/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536100_A/Massachusetts/0      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535909_A/Massachusetts/0      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535834_A/California/14/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892704_A/Canada-ON/RV152      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229598877_A/Ohio/07/2009         AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396504_A/Ohio/07/2009         AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396494_A/Ohio/07/2009         AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892702_A/Canada-ON/RV152      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229783398_A/New_York/1682/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511819_A/Mexico/4108/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536049_A/Arizona/02/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536088_A/Indiana/09/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229484027_A/Canada-NS/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892700_A/Canada-NS/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892710_A/Canada-NS/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511821_A/Mexico/4115/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511811_A/Mexico/4482/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511799_A/Mexico/4486/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511817_A/Mexico/4603/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511795_A/Mexico/4604/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229783367_A/Korea/01/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229783377_A/New_York/1669/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536022_A/Arizona/01/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536003_A/Kansas/02/2009       AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536121_A/Michigan/02/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229598896_A/Texas/15/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229609563_A/Catalonia/P154/      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 175
gi|229299521_A/Texas/04/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228860929_A/Netherlands/602      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229484029_A/Mexico/InDRE448      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535997_A/South_Carolina/      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229609557_A/Catalonia/P148/      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 176
gi|229299515_A/Texas/04/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396467_A/Texas/06/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535816_A/Texas/09/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535985_A/Texas/08/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536075_A/Texas/07/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229368677_A/Denmark/513/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831826_A/Texas/04/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831774_A/Texas/05/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831776_A/California/06/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831759_A/California/05/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227977104_A/California/10/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536135_A/Colorado/03/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228481046_A/Auckland/1/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 158
gi|237624327_A/swine/Alberta/O      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536010_A/Kansas/03/2009       AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228495370_A/Regensburg/Germ      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 160
gi|229892706A/Mexico/InDRE4114      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535949_A/California/04/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227809830_A/California/04/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229299517_A/California/07/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228017758_A/California/08/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227977172_A/California/07/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
                                     *************************************************

gi|229396357_A/New_York/12/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892708_A/Canada-AB/RV153      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396399_A/New_York/18/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536064_A/New_York/20/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536055_A/New_York/20/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396487_A/New_York/19/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227977099_A/New_York/19/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396410_A/New_York/31/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396419_A/New_York/23/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396381_A/New_York/11/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396443_A/New_York/10/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229484031_A/Canada-ON/RV152      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535797_A/New_York/22/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536129_A/New_York/13/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536100_A/Massachusetts/0      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535909_A/Massachusetts/0      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535834_A/California/14/2      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892704_A/Canada-ON/RV152      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229598877_A/Ohio/07/2009         TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396504_A/Ohio/07/2009         TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396494_A/Ohio/07/2009         TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892702_A/Canada-ON/RV152      TSADQQSLYQNADAYVFVGXSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229783398_A/New_York/1682/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511819_A/Mexico/4108/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536049_A/Arizona/02/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536088_A/Indiana/09/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229484027_A/Canada-NS/RV153      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892700_A/Canada-NS/RV153      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892710_A/Canada-NS/RV153      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511821_A/Mexico/4115/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511811_A/Mexico/4482/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511799_A/Mexico/4486/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511817_A/Mexico/4603/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511795_A/Mexico/4604/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229783367_A/Korea/01/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229783377_A/New_York/1669/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536022_A/Arizona/01/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536003_A/Kansas/02/2009       TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536121_A/Michigan/02/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229598896_A/Texas/15/2009        TSADQQSLYQNADAYVFVGSSRYSKKLKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229609563_A/Catalonia/P154/      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 225
gi|229299521_A/Texas/04/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228860929_A/Netherlands/602      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229484029_A/Mexico/InDRE448      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535997_A/South_Carolina/      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229609557_A/Catalonia/P148/      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 226
gi|229299515_A/Texas/04/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396467_A/Texas/06/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535816_A/Texas/09/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535985_A/Texas/08/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536075_A/Texas/07/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229368677_A/Denmark/513/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831826_A/Texas/04/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831774_A/Texas/05/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831776_A/California/06/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831759_A/California/05/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227977104_A/California/10/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536135_A/Colorado/03/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228481046_A/Auckland/1/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 208
gi|237624327_A/swine/Alberta/O      TSADQQSLYQNADANVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536010_A/Kansas/03/2009       TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228495370_A/Regensburg/Germ      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 210
gi|229892706A/Mexico/InDRE4114      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRGQEGRMNYYWTL 250
gi|229535949_A/California/04/2      TSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227809830_A/California/04/2      TSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229299517_A/California/07/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228017758_A/California/08/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227977172_A/California/07/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRXXEGRMNYYWTL 250
                                    *************: **** ******:***********  **********

gi|229396357_A/New_York/12/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892708_A/Canada-AB/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396399_A/New_York/18/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536064_A/New_York/20/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536055_A/New_York/20/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396487_A/New_York/19/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227977099_A/New_York/19/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396410_A/New_York/31/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396419_A/New_York/23/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396381_A/New_York/11/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396443_A/New_York/10/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229484031_A/Canada-ON/RV152      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535797_A/New_York/22/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536129_A/New_York/13/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536100_A/Massachusetts/0      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535909_A/Massachusetts/0      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535834_A/California/14/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892704_A/Canada-ON/RV152      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229598877_A/Ohio/07/2009         VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396504_A/Ohio/07/2009         VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396494_A/Ohio/07/2009         VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892702_A/Canada-ON/RV152      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229783398_A/New_York/1682/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCDTTCQTPK 300
gi|237511819_A/Mexico/4108/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536049_A/Arizona/02/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536088_A/Indiana/09/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229484027_A/Canada-NS/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892700_A/Canada-NS/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892710_A/Canada-NS/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511821_A/Mexico/4115/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511811_A/Mexico/4482/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511799_A/Mexico/4486/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511817_A/Mexico/4603/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511795_A/Mexico/4604/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229783367_A/Korea/01/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229783377_A/New_York/1669/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536022_A/Arizona/01/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536003_A/Kansas/02/2009       VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536121_A/Michigan/02/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229598896_A/Texas/15/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229609563_A/Catalonia/P154/      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 275
gi|229299521_A/Texas/04/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228860929_A/Netherlands/602      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229484029_A/Mexico/InDRE448      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535997_A/South_Carolina/      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHECNTTCQTPK 300
gi|229609557_A/Catalonia/P148/      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHECNTTCQTPK 276
gi|229299515_A/Texas/04/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396467_A/Texas/06/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535816_A/Texas/09/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535985_A/Texas/08/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536075_A/Texas/07/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229368677_A/Denmark/513/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831826_A/Texas/04/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831774_A/Texas/05/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831776_A/California/06/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831759_A/California/05/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227977104_A/California/10/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536135_A/Colorado/03/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228481046_A/Auckland/1/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 258
gi|237624327_A/swine/Alberta/O      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536010_A/Kansas/03/2009       VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228495370_A/Regensburg/Germ      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 260
gi|229892706A/Mexico/InDRE4114      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535949_A/California/04/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227809830_A/California/04/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229299517_A/California/07/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228017758_A/California/08/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227977172_A/California/07/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
                                    ****************************************:*:*******

gi|229396357_A/New_York/12/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892708_A/Canada-AB/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396399_A/New_York/18/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536064_A/New_York/20/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536055_A/New_York/20/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396487_A/New_York/19/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227977099_A/New_York/19/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396410_A/New_York/31/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396419_A/New_York/23/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396381_A/New_York/11/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396443_A/New_York/10/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229484031_A/Canada-ON/RV152      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535797_A/New_York/22/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536129_A/New_York/13/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536100_A/Massachusetts/0      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535909_A/Massachusetts/0      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535834_A/California/14/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892704_A/Canada-ON/RV152      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229598877_A/Ohio/07/2009         GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396504_A/Ohio/07/2009         GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396494_A/Ohio/07/2009         GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892702_A/Canada-ON/RV152      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229783398_A/New_York/1682/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511819_A/Mexico/4108/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536049_A/Arizona/02/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536088_A/Indiana/09/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229484027_A/Canada-NS/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892700_A/Canada-NS/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892710_A/Canada-NS/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511821_A/Mexico/4115/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511811_A/Mexico/4482/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511799_A/Mexico/4486/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511817_A/Mexico/4603/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511795_A/Mexico/4604/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229783367_A/Korea/01/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229783377_A/New_York/1669/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536022_A/Arizona/01/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536003_A/Kansas/02/2009       GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536121_A/Michigan/02/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229598896_A/Texas/15/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229609563_A/Catalonia/P154/      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 325
gi|229299521_A/Texas/04/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|228860929_A/Netherlands/602      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229484029_A/Mexico/InDRE448      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535997_A/South_Carolina/      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229609557_A/Catalonia/P148/      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 326
gi|229299515_A/Texas/04/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396467_A/Texas/06/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535816_A/Texas/09/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535985_A/Texas/08/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536075_A/Texas/07/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229368677_A/Denmark/513/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831826_A/Texas/04/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831774_A/Texas/05/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831776_A/California/06/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831759_A/California/05/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227977104_A/California/10/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536135_A/Colorado/03/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|228481046_A/Auckland/1/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 308
gi|237624327_A/swine/Alberta/O      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536010_A/Kansas/03/2009       GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|228495370_A/Regensburg/Germ      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 310
gi|229892706A/Mexico/InDRE4114      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535949_A/California/04/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|227809830_A/California/04/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|229299517_A/California/07/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|228017758_A/California/08/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|227977172_A/California/07/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
                                    *************************************:************

gi|229396357_A/New_York/12/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229892708_A/Canada-AB/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396399_A/New_York/18/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536064_A/New_York/20/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536055_A/New_York/20/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396487_A/New_York/19/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227977099_A/New_York/19/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396410_A/New_York/31/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396419_A/New_York/23/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396381_A/New_York/11/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396443_A/New_York/10/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229484031_A/Canada-ON/RV152      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535797_A/New_York/22/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536129_A/New_York/13/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536100_A/Massachusetts/0      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535909_A/Massachusetts/0      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535834_A/California/14/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229892704_A/Canada-ON/RV152      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229598877_A/Ohio/07/2009         AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396504_A/Ohio/07/2009         AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396494_A/Ohio/07/2009         AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229892702_A/Canada-ON/RV152      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229783398_A/New_York/1682/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511819_A/Mexico/4108/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536049_A/Arizona/02/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536088_A/Indiana/09/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229484027_A/Canada-NS/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVV 400
gi|229892700_A/Canada-NS/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVV 400
gi|229892710_A/Canada-NS/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVV 400
gi|237511821_A/Mexico/4115/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511811_A/Mexico/4482/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511799_A/Mexico/4486/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511817_A/Mexico/4603/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511795_A/Mexico/4604/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229783367_A/Korea/01/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229783377_A/New_York/1669/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536022_A/Arizona/01/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536003_A/Kansas/02/2009       AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536121_A/Michigan/02/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229598896_A/Texas/15/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229609563_A/Catalonia/P154/      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 375
gi|229299521_A/Texas/04/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228860929_A/Netherlands/602      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229484029_A/Mexico/InDRE448      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535997_A/South_Carolina/      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229609557_A/Catalonia/P148/      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 376
gi|229299515_A/Texas/04/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396467_A/Texas/06/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535816_A/Texas/09/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535985_A/Texas/08/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536075_A/Texas/07/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229368677_A/Denmark/513/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831826_A/Texas/04/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831774_A/Texas/05/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831776_A/California/06/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831759_A/California/05/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227977104_A/California/10/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536135_A/Colorado/03/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228481046_A/Auckland/1/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 358
gi|237624327_A/swine/Alberta/O      VGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536010_A/Kansas/03/2009       AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228495370_A/Regensburg/Germ      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 360
gi|229892706A/Mexico/InDRE4114      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535949_A/California/04/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227809830_A/California/04/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229299517_A/California/07/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228017758_A/California/08/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227977172_A/California/07/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
                                    .************************************************:

gi|229396357_A/New_York/12/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892708_A/Canada-AB/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396399_A/New_York/18/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536064_A/New_York/20/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536055_A/New_York/20/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396487_A/New_York/19/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227977099_A/New_York/19/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396410_A/New_York/31/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396419_A/New_York/23/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396381_A/New_York/11/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396443_A/New_York/10/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229484031_A/Canada-ON/RV152      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535797_A/New_York/22/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536129_A/New_York/13/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536100_A/Massachusetts/0      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535909_A/Massachusetts/0      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535834_A/California/14/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892704_A/Canada-ON/RV152      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229598877_A/Ohio/07/2009         EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229396504_A/Ohio/07/2009         EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229396494_A/Ohio/07/2009         EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229892702_A/Canada-ON/RV152      EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229783398_A/New_York/1682/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511819_A/Mexico/4108/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLILLENER 450
gi|229536049_A/Arizona/02/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536088_A/Indiana/09/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229484027_A/Canada-NS/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892700_A/Canada-NS/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892710_A/Canada-NS/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511821_A/Mexico/4115/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511811_A/Mexico/4482/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511799_A/Mexico/4486/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511817_A/Mexico/4603/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511795_A/Mexico/4604/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229783367_A/Korea/01/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229783377_A/New_York/1669/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536022_A/Arizona/01/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536003_A/Kansas/02/2009       EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536121_A/Michigan/02/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229598896_A/Texas/15/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229609563_A/Catalonia/P154/      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 425
gi|229299521_A/Texas/04/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228860929_A/Netherlands/602      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229484029_A/Mexico/InDRE448      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535997_A/South_Carolina/      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229609557_A/Catalonia/P148/      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 426
gi|229299515_A/Texas/04/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396467_A/Texas/06/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535816_A/Texas/09/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535985_A/Texas/08/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536075_A/Texas/07/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229368677_A/Denmark/513/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831826_A/Texas/04/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831774_A/Texas/05/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831776_A/California/06/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831759_A/California/05/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227977104_A/California/10/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536135_A/Colorado/03/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228481046_A/Auckland/1/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 408
gi|237624327_A/swine/Alberta/O      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536010_A/Kansas/03/2009       EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228495370_A/Regensburg/Germ      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 410
gi|229892706A/Mexico/InDRE4114      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535949_A/California/04/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227809830_A/California/04/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229299517_A/California/07/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228017758_A/California/08/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227977172_A/California/07/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
                                    ***************************:***************:******

gi|229396357_A/New_York/12/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892708_A/Canada-AB/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396399_A/New_York/18/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536064_A/New_York/20/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536055_A/New_York/20/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396487_A/New_York/19/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227977099_A/New_York/19/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396410_A/New_York/31/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396419_A/New_York/23/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396381_A/New_York/11/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396443_A/New_York/10/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229484031_A/Canada-ON/RV152      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535797_A/New_York/22/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536129_A/New_York/13/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536100_A/Massachusetts/0      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535909_A/Massachusetts/0      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535834_A/California/14/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892704_A/Canada-ON/RV152      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229598877_A/Ohio/07/2009         TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396504_A/Ohio/07/2009         TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396494_A/Ohio/07/2009         TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892702_A/Canada-ON/RV152      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229783398_A/New_York/1682/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511819_A/Mexico/4108/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536049_A/Arizona/02/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536088_A/Indiana/09/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229484027_A/Canada-NS/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892700_A/Canada-NS/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892710_A/Canada-NS/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511821_A/Mexico/4115/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511811_A/Mexico/4482/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511799_A/Mexico/4486/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511817_A/Mexico/4603/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511795_A/Mexico/4604/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229783367_A/Korea/01/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229783377_A/New_York/1669/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536022_A/Arizona/01/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536003_A/Kansas/02/2009       TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536121_A/Michigan/02/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229598896_A/Texas/15/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229609563_A/Catalonia/P154/      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 475
gi|229299521_A/Texas/04/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228860929_A/Netherlands/602      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229484029_A/Mexico/InDRE448      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535997_A/South_Carolina/      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229609557_A/Catalonia/P148/      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 476
gi|229299515_A/Texas/04/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396467_A/Texas/06/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535816_A/Texas/09/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535985_A/Texas/08/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536075_A/Texas/07/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229368677_A/Denmark/513/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831826_A/Texas/04/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831774_A/Texas/05/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831776_A/California/06/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831759_A/California/05/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227977104_A/California/10/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536135_A/Colorado/03/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228481046_A/Auckland/1/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 458
gi|237624327_A/swine/Alberta/O      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536010_A/Kansas/03/2009       TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228495370_A/Regensburg/Germ      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 460
gi|229892706A/Mexico/InDRE4114      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535949_A/California/04/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227809830_A/California/04/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229299517_A/California/07/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228017758_A/California/08/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227977172_A/California/07/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
                                    **************************************************

gi|229396357_A/New_York/12/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892708_A/Canada-AB/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396399_A/New_York/18/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536064_A/New_York/20/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536055_A/New_York/20/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396487_A/New_York/19/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227977099_A/New_York/19/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396410_A/New_York/31/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396419_A/New_York/23/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396381_A/New_York/11/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396443_A/New_York/10/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229484031_A/Canada-ON/RV152      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535797_A/New_York/22/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536129_A/New_York/13/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536100_A/Massachusetts/0      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535909_A/Massachusetts/0      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535834_A/California/14/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892704_A/Canada-ON/RV152      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229598877_A/Ohio/07/2009         YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396504_A/Ohio/07/2009         YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396494_A/Ohio/07/2009         YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892702_A/Canada-ON/RV152      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229783398_A/New_York/1682/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511819_A/Mexico/4108/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536049_A/Arizona/02/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536088_A/Indiana/09/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229484027_A/Canada-NS/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892700_A/Canada-NS/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892710_A/Canada-NS/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511821_A/Mexico/4115/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511811_A/Mexico/4482/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511799_A/Mexico/4486/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511817_A/Mexico/4603/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511795_A/Mexico/4604/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229783367_A/Korea/01/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229783377_A/New_York/1669/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536022_A/Arizona/01/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536003_A/Kansas/02/2009       YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536121_A/Michigan/02/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229598896_A/Texas/15/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229609563_A/Catalonia/P154/      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 525
gi|229299521_A/Texas/04/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228860929_A/Netherlands/602      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229484029_A/Mexico/InDRE448      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535997_A/South_Carolina/      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229609557_A/Catalonia/P148/      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 526
gi|229299515_A/Texas/04/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396467_A/Texas/06/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535816_A/Texas/09/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535985_A/Texas/08/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536075_A/Texas/07/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229368677_A/Denmark/513/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831826_A/Texas/04/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831774_A/Texas/05/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831776_A/California/06/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831759_A/California/05/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227977104_A/California/10/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536135_A/Colorado/03/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228481046_A/Auckland/1/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 508
gi|237624327_A/swine/Alberta/O      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536010_A/Kansas/03/2009       YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228495370_A/Regensburg/Germ      YDYPKYSEEAKLNREEIDGVK----------------------------- 481
gi|229892706A/Mexico/InDRE4114      YDYPKYSEEAKLNREEIDGVKLESTRFYQILAIYSTVASSLVLVVSLGAI 550
gi|229535949_A/California/04/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227809830_A/California/04/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229299517_A/California/07/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228017758_A/California/08/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227977172_A/California/07/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
                                    *********************                             

gi|229396357_A/New_York/12/200      SFWMCSNGSLQCRICI 566
gi|229892708_A/Canada-AB/RV153      SFWMCSNGSLQCRICI 566
gi|229396399_A/New_York/18/200      SFWMCSNGSLQCRICI 566
gi|229536064_A/New_York/20/200      SFWMCSNGSLQCRICI 566
gi|229536055_A/New_York/20/200      SFWMCSNGSLQCRICI 566
gi|229396487_A/New_York/19/200      SFWMCSNGSLQCRICI 566
gi|227977099_A/New_York/19/200      SFWMCSNGSLQCRICI 566
gi|229396410_A/New_York/31/200      SFWMCSNGSLQCRICI 566
gi|229396419_A/New_York/23/200      SFWMCSNGSLQCRICI 566
gi|229396381_A/New_York/11/200      SFWMCSNGSLQCRICI 566
gi|229396443_A/New_York/10/200      SFWMCSNGSLQCRICI 566
gi|229484031_A/Canada-ON/RV152      SFWMCSNGSLQCRICI 566
gi|229535797_A/New_York/22/200      SFWMCSNGSLQCRICI 566
gi|229536129_A/New_York/13/200      SFWMCSNGSLQCRICI 566
gi|229536100_A/Massachusetts/0      SFWMCSNGSLQCRICI 566
gi|229535909_A/Massachusetts/0      SFWMCSNGSLQCRICI 566
gi|229535834_A/California/14/2      SFWMCSNGSLQCRICI 566
gi|229892704_A/Canada-ON/RV152      SFWMCSNGSLQCRICI 566
gi|229598877_A/Ohio/07/2009         SFWMCSNGSLQCRICI 566
gi|229396504_A/Ohio/07/2009         SFWMCSNGSLQCRICI 566
gi|229396494_A/Ohio/07/2009         SFWMCSNGSLQCRICI 566
gi|229892702_A/Canada-ON/RV152      SFWMCSNGSLQCRICI 566
gi|229783398_A/New_York/1682/2      SFWMCSNGSLQCRICI 566
gi|237511819_A/Mexico/4108/200      SFWMCSNGSLQCRICI 566
gi|229536049_A/Arizona/02/2009      SFWMCSNGSLQCRICI 566
gi|229536088_A/Indiana/09/2009      SFWMCSNGSLQCRICI 566
gi|229484027_A/Canada-NS/RV153      SFWMCSNGSLQCRICI 566
gi|229892700_A/Canada-NS/RV153      SFWMCSNGSLQCRICI 566
gi|229892710_A/Canada-NS/RV153      SFWMCSNGSLQCRICI 566
gi|237511821_A/Mexico/4115/200      SFWMCSNGSLQCRICI 566
gi|237511811_A/Mexico/4482/200      SFWMCSNGSLQCRICI 566
gi|237511799_A/Mexico/4486/200      SFWMCSNGSLQCRICI 566
gi|237511817_A/Mexico/4603/200      SFWMCSNGSLQCRICI 566
gi|237511795_A/Mexico/4604/200      SFWMCSNGSLQCRICI 566
gi|229783367_A/Korea/01/2009        SFWMCSNGSLQCRICI 566
gi|229783377_A/New_York/1669/2      SFWMCSNGSLQCRICI 566
gi|229536022_A/Arizona/01/2009      SFWMCSNGSLQCRICI 566
gi|229536003_A/Kansas/02/2009       SFWMCSNGSLQCRICI 566
gi|229536121_A/Michigan/02/200      SFWMCSNGSLQCRICI 566
gi|229598896_A/Texas/15/2009        SFWMCSNGSLQCRICI 566
gi|229609563_A/Catalonia/P154/      SFWMCSNG-------- 533
gi|229299521_A/Texas/04/2009        SFWMCSNGSLQCRICI 566
gi|228860929_A/Netherlands/602      SFWMCSNGSLQCRICI 566
gi|229484029_A/Mexico/InDRE448      SFWMCSNGSLQCRICI 566
gi|229535997_A/South_Carolina/      SFWMCSNGSLQCRICI 566
gi|229609557_A/Catalonia/P148/      SFWMCSNG-------- 534
gi|229299515_A/Texas/04/2009        SFWMCSNGSLQCRICI 566
gi|229396467_A/Texas/06/2009        SFWMCSNGSLQCRICI 566
gi|229535816_A/Texas/09/2009        SFWMCSNGSLQCRICI 566
gi|229535985_A/Texas/08/2009        SFWMCSNGSLQCRICI 566
gi|229536075_A/Texas/07/2009        SFWMCSNGSLQCRICI 566
gi|229368677_A/Denmark/513/200      SFWMCSNGSLQCRICI 566
gi|227831826_A/Texas/04/2009        SFWMCSNGSLQCRICI 566
gi|227831774_A/Texas/05/2009        SFWMCSNGSLQCRICI 566
gi|227831776_A/California/06/2      SFWMCSNGSLQCRICI 566
gi|227831759_A/California/05/2      SFWMCSNGSLQCRICI 566
gi|227977104_A/California/10/2      SFWMCSNGSLQCRICI 566
gi|229536135_A/Colorado/03/200      SFWMCSNGSLQCRICI 566
gi|228481046_A/Auckland/1/2009      SFWMCSNGSLQCRICI 524
gi|237624327_A/swine/Alberta/O      SFWMCSNGSLQCRICI 566
gi|229536010_A/Kansas/03/2009       SFWMCSNGSLQCRICI 566
gi|228495370_A/Regensburg/Germ      ----------------
gi|229892706A/Mexico/InDRE4114      SFWMCSNGSLQCRICI 566
gi|229535949_A/California/04/2      SFWMCSNGSLQCRICI 566
gi|227809830_A/California/04/2      SFWMCSNGSLQCRICI 566
gi|229299517_A/California/07/2      SFWMCSNGSLQCRICI 566
gi|228017758_A/California/08/2      SFWMCSNGSLQCRICI 566
gi|227977172_A/California/07/2      SFWMCSNGSLQCRICI 566

BLAST

>gb|ABQ42446.1|  hemagglutinin [Influenza A virus (A/swine/Guangxi/17/2005(H1N2))]
Length=566

 Score = 1145 bits (2962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/566 (95%), Positives = 558/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFIDYEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFIDYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHDSN+GVTAACPHAGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDSNRGVTAACPHAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLW IHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWSIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAIKRNSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGA+SFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAVSFWMCSNGSLQCRICI  566


>gb|AAL87865.1|AF455675_1  hemagglutinin [Influenza A virus (A/Swine/Ohio/891/01(H1N2))]
Length=566

 Score = 1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/566 (95%), Positives = 559/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAGAKSFY+NLIWLVKKGNSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGAKSFYRNLIWLVKKGNSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF75994.1|AF250124_1  hemagglutinin [influenza A virus (A/Swine/Indiana/9K035/99 (H1N2))]
Length=566

 Score = 1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/566 (95%), Positives = 558/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAGA SFY+NLIWLVKKGNSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGANSFYRNLIWLVKKGNSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL87870.1|AF455680_1  hemagglutinin [Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2))]
Length=566

 Score = 1138 bits (2943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/566 (95%), Positives = 557/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETSSSDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSSSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACP+AGAKSFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPYAGAKSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GR+NYYWTLVEPGDKITFEATGNLVVPRYAFAMERN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  AGRINYYWTLVEPGDKITFEATGNLVVPRYAFAMERNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQF AVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFIAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELL+LLENERTLDYHDSNVKNLYEKVRSQLKNNA+EIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLILLENERTLDYHDSNVKNLYEKVRSQLKNNAREIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+ CMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDKCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ABV25639.1|  hemagglutinin [Influenza A virus (A/swine/Minnesota/1192/2001(H1N2))]
Length=566

 Score = 1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/566 (95%), Positives = 556/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTTSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+++GVTAACPHAGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDADRGVTAACPHAGASSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWT+VEPGDKITFEATGNLVVPRYAFAM+RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  AGRMNYYWTIVEPGDKITFEATGNLVVPRYAFAMKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHPITIG+CPKYVKSTKLR+ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPITIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDY KYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYSKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL29710.1|  hemagglutinin [Influenza A virus (A/SW/MN/23124-T/01(H1N2))]
 gb|AAL29711.1|  hemagglutinin [Influenza A virus (A/SW/MN/23124-S/01(H1N2))]
Length=566

 Score = 1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/566 (95%), Positives = 557/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAGA SFY+NLIWLVKKGNSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGANSFYRNLIWLVKKGNSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNH E+R
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHPERR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ABQ42444.1|  hemagglutinin [Influenza A virus (A/swine/Guangxi/13/2006(H1N2))]
Length=566

 Score = 1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/566 (95%), Positives = 557/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTASADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFIDYEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFIDYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWP+HDSN+GVTAACPHAGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPDHDSNRGVTAACPHAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHP TSA+QQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPPTSANQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFAM+RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEFN LE+R
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNQLERR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL+REEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLHREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQC+ICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCKICI  566


>gb|ABV25641.1|  hemagglutinin [Influenza A virus (A/swine/Minnesota/00194/2003(H1N2))]
Length=566

 Score = 1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/566 (94%), Positives = 556/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNG CYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGACYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAG  SFY+NLIWLVKKGNSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGTNSFYRNLIWLVKKGNSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYS+KF+PEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSRKFEPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNT CQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTACQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKN+YEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNIYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL29713.1|  hemagglutinin [Influenza A virus (A/SW/MN/16419/01(H1N2))]
Length=566

 Score = 1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/566 (94%), Positives = 555/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE +HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEGRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAG  SFY+NLIWLVKKGNSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGTNSFYRNLIWLVKKGNSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNT CQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTICQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRIC+
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICM  566


>gb|AAL87871.1|AF455681_1  hemagglutinin [Influenza A virus (A/Swine/Illinois/100085A/01 
(H1N2))]
Length=566

 Score = 1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/566 (94%), Positives = 556/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLH+GKCNIAGW+LGNPECESL TASSWSYIVETS+S+NGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHMGKCNIAGWLLGNPECESLFTASSWSYIVETSNSENGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAGA SFY+NLIWLVKKG+SYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGANSFYRNLIWLVKKGDSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGS RYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSLRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT V+DCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVYDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQF AVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFKAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ACH69547.1|  hemagglutinin [Influenza A virus (A/swine/OH/511445/2007(H1N1))]
Length=566

 Score = 1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/566 (93%), Positives = 556/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE++HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESLSTASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLSTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACPHAG  SFY+NLIWLVKKGNSYPK++K
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPHAGTNSFYRNLIWLVKKGNSYPKINK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLW IHHPSTSADQQSLYQNADAYVFVGSSRYS+KF+PEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWAIHHPSTSADQQSLYQNADAYVFVGSSRYSRKFEPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDC+TTCQTP 
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCDTTCQTPN  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEF+HLE+R
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFSHLERR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAK71687.1|  hemagglutinin [Influenza A virus (A/Turkey/MO/24093/99(H1N2))]
Length=566

 Score = 1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/566 (94%), Positives = 552/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFP+TSSWPNHD+N+GVTAACPHAGA SFY+NLIWL KKG+SYPKLSK
Sbjct  121  QLSSVSSFERFEIFPETSSWPNHDTNRGVTAACPHAGANSFYRNLIWLAKKGDSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHP TSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPPTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFAM+RN+ SGIIISD  VHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMKRNSESGIIISDISVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFT VGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTVVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLG ISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGTISFWMCSNGSLQCRICI  566


>gb|AAL87872.1|AF455682_1  hemagglutinin [Influenza A virus (A/Swine/Illinois/100084/01 
(H1N2))]
Length=566

 Score = 1127 bits (2914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/566 (94%), Positives = 553/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLH+GKCNIAGW+LGNPECESL TASSWSYIVETS+S+NGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHMGKCNIAGWLLGNPECESLFTASSWSYIVETSNSENGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSV SFERFEIFPKTSSWPNHD+N+GVTAACPHAGA SFY+NLIWLVKKGNSYPK+SK
Sbjct  121  QLSSVLSFERFEIFPKTSSWPNHDTNRGVTAACPHAGANSFYRNLIWLVKKGNSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQN DAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNEDAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT  HDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSAHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+A GLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMARGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQF AVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFKAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ABV25642.1|  hemagglutinin [Influenza A virus (A/swine/Kansas/00246/2004(H1N2))]
Length=566

 Score = 1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/566 (93%), Positives = 555/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDT+LEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTILEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TA SWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTARSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFP TSSWPNHD+N+GVTAACPHAG KSFY+NLIWLVKKG+SYPK+SK
Sbjct  121  QLSSVSSFERFEIFPNTSSWPNHDTNRGVTAACPHAGTKSFYRNLIWLVKKGDSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSS+YSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSKYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRM+YYWT+VEPGDKITFEATGNLVVPRYAF ++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMDYYWTIVEPGDKITFEATGNLVVPRYAFELKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKV+SQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVKSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+ CMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDMCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLIVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77934.1|  hemagglutinin [Influenza A virus (A/swine/Korea/PZ4/2006(H1N2))]
Length=566

 Score = 1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/566 (93%), Positives = 555/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLITASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++++GVTAACPHAG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHNTDRGVTAACPHAGTSSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ++LYQNADAYVFVGSSRYSKKF PEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQRTLYQNADAYVFVGSSRYSKKFTPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77935.1|  hemagglutinin [Influenza A virus (A/swine/Korea/PZ7/2006(H1N2))]
 gb|ACE77936.1|  hemagglutinin [Influenza A virus (A/swine/Korea/PZ14/2006(H1N2))]
Length=566

 Score = 1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/566 (93%), Positives = 555/566 (98%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLITASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFP+TSSWPNH++++GVTAACPHAG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPRTSSWPNHNTDRGVTAACPHAGTSSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ++LYQNADAYVFVGSSRYSKKF PEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQRTLYQNADAYVFVGSSRYSKKFTPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL87867.1|AF455677_1  hemagglutinin [Influenza A virus (A/Swine/North Carolina/93523/01 
(H1N2))]
Length=565

 Score = 1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/566 (94%), Positives = 553/566 (97%), Gaps = 1/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TA ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTAKADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTS WPNHD+N+GVTAACPHAGA SFY+NLIWLV+K NSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTS-WPNHDTNRGVTAACPHAGANSFYRNLIWLVEKENSYPKLSK  179

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K  EVLVLWGIHHPSTSADQ+SLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ
Sbjct  180  SYINNKEMEVLVLWGIHHPSTSADQRSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  239

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGDKITFEATGNLVVPRYAFAM+R +GSGIIISDT VHDCNTTCQTPK
Sbjct  240  AGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMKRGSGSGIIISDTSVHDCNTTCQTPK  299

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQN+HP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  300  GAINTSLPFQNVHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  359

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  360  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  419

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  420  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  479

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  480  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  539

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  540  LVLVVSLGAISFWMCSNGSLQCRICI  565


>gb|ABW71521.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/24297/1991(H1N1))]
Length=566

 Score = 1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/566 (93%), Positives = 552/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77937.1|  hemagglutinin [Influenza A virus (A/swine/Korea/CY08/2007(H1N2))]
Length=566

 Score = 1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/566 (93%), Positives = 554/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLITASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFP+TSSWPNH++++GVTAACPHAG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPRTSSWPNHNTDRGVTAACPHAGTSSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ++LYQNADAYVFVGSSRYSKKF PEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQRTLYQNADAYVFVGSSRYSKKFTPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ABG34254.1|  hemagglutinin [Influenza A virus (A/swine/Korea/S11/2005(H1N2))]
Length=566

 Score = 1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/566 (93%), Positives = 552/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTFATAN+DTLCIGYHANNSTDTVDT+LE+N+TVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFATANSDTLCIGYHANNSTDTVDTILERNITVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNP CESL TASSWSYIVE S+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPGCESLFTASSWSYIVEKSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTA+CPHAG KSFY+NLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTASCPHAGTKSFYRNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN K KEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIA RPKVRDQ
Sbjct  181  SYINSKEKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWT+VEPGDKITFEATGNLVVPRYA A++RN+GSGIIISDT VHD NT CQTPK
Sbjct  241  EGRMNYYWTIVEPGDKITFEATGNLVVPRYALALKRNSGSGIIISDTSVHDGNTACQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID ITNKVNSVIEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREE+DGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEVDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGA SFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGATSFWMCSNGSLQCRICI  566


>gb|ACE77931.1|  hemagglutinin [Influenza A virus (A/swine/Korea/JL02/2005(H1N2))]
Length=566

 Score = 1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/566 (93%), Positives = 553/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLITASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFP+TSSWPNH++++GVTAACPHAG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPRTSSWPNHNTDRGVTAACPHAGTSSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ +LYQNADAYVFVGSSRYSKKF PEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQLTLYQNADAYVFVGSSRYSKKFTPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR29565.1|  hemagglutinin [Influenza A virus (A/swine/Maryland/23239/1991(H1N1))]
 gb|ACI26604.1|  hemagglutinin [Influenza A virus (A/swine/Memphis/1/1990(H1N1))]
Length=566

 Score = 1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/566 (93%), Positives = 551/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACF25596.1|  hemagglutinin [Influenza A virus (A/turkey/IA/21089-3/1992(H1N1))]
Length=566

 Score = 1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/566 (93%), Positives = 551/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR29585.1|  hemagglutinin [Influenza A virus (A/swine/Wisconsin/1915/1988(H1N1))]
Length=566

 Score = 1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/566 (92%), Positives = 551/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQG+GYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGTGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77929.1|  hemagglutinin [Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2))]
Length=566

 Score = 1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/566 (93%), Positives = 551/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL  ASSWSYIVETS+ DNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLIAASSWSYIVETSNPDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACP AG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPLAGTNSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ++LYQNADAYVFVGSSRYSKKF PEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQRTLYQNADAYVFVGSSRYSKKFTPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+ IG+CPKYVKSTKL++ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVXIGECPKYVKSTKLKMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR29595.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/17672/1988(H1N1))]
 gb|ACD88703.1|  hemagglutinin [Influenza A virus (A/turkey/NC/19762/1988(H1N1))]
Length=566

 Score = 1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABU80400.1|  hemagglutinin [Influenza A virus (A/Ohio/3559/1988(H1N1))]
Length=566

 Score = 1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLN+KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNRKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77933.1|  hemagglutinin [Influenza A virus (A/swine/Korea/Asan04/2006(H1N2))]
Length=566

 Score = 1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/566 (92%), Positives = 551/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL  ASSWSYIVETS+ DNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLIAASSWSYIVETSNPDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACP AG  SFYKNLIWL+KK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPLAGTNSFYKNLIWLIKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ++LYQNADAYVFVGSSRYSKKF PEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQRTLYQNADAYVFVGSSRYSKKFTPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKL++ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLKMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77932.1|  hemagglutinin [Influenza A virus (A/swine/Korea/JL04/2005(H1N2))]
Length=566

 Score = 1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/566 (93%), Positives = 551/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL  ASSWSYIVETS+ DNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLIAASSWSYIVETSNPDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACP AG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPLAGTNSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ++LYQNADAYVFV SSRYSKKF PEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQRTLYQNADAYVFVESSRYSKKFTPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKL++ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLKMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77930.1|  hemagglutinin [Influenza A virus (A/swine/Korea/JL01/2005(H1N2))]
Length=566

 Score = 1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/566 (93%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL  ASSWSYIVETS+ DNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLIAASSWSYIVETSNPDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNHD+N+GVTAACP AG  SFYKNLIWLVKK NSYPK+SK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHDTNRGVTAACPLAGTNSFYKNLIWLVKKENSYPKISK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPS SADQ +LYQNADAYVFVGSSRYSKKF PEI  RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSNSADQLTLYQNADAYVFVGSSRYSKKFTPEITTRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
            EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFA++RN+GSGIIISDT VHDCNTTCQTPK
Sbjct  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFALKRNSGSGIIISDTSVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKL++ATGLRNVPSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLKMATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAI+ ITNKVNS+IEKMNTQFTAVGKEF+HLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAINGITNKVNSIIEKMNTQFTAVGKEFSHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKL RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLTREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLQCRICI  566


>gb|AAA43283.1|  hemagglutinin [Influenza A virus (A/MD/12/1991(H1N1))]
Length=566

 Score = 1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWP+H++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPDHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAB03291.1|  hemagglutinin [Influenza A virus (A/WI/4754/1994(H1N1))]
 gb|AAB03292.1|  hemagglutinin [Influenza A virus (A/WI/4755/1994(H1N1))]
Length=566

 Score = 1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLSVSLGAISFWMCSNGSLQCRICI  566


>gb|ABY84684.1|  hemagglutinin [Influenza A virus (A/swine/California/T9001707/1991(H1N1))]
Length=566

 Score = 1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/566 (93%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYT  TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTVTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF87280.1|AF222032_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/235/97(H1N1))]
 gb|AAF87281.1|AF222033_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/238/97(H1N1))]
Length=566

 Score = 1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L+G+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LKGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVT+ACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTSACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGK+VLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKF PEIA RPKVR Q
Sbjct  181  SYINNKGKKVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFMPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAMER  GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMERGYGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKV+SQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVKSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYST+ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTIASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR29575.1|  hemagglutinin [Influenza A virus (A/swine/Kansas/3228/1987(H1N1))]
 gb|ABU80420.1|  hemagglutinin [Influenza A virus (A/swine/Kansas/3024/1987(H1N1))]
Length=566

 Score = 1112 bits (2875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACN50264.1|  hemagglutinin [Influenza A virus (A/swine/Shanghai/3/2005(H1N1))]
Length=566

 Score = 1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILV LLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVFLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFE+FPK+SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEMFPKSSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TSADQQSLYQNADAYVFVGSS+Y+KKF+PEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSADQQSLYQNADAYVFVGSSKYNKKFRPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKST LR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTNLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDG LD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGLLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESV+NGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVRNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACI41022.1|  hemagglutinin [Influenza A virus (A/turkey/NC/17026/1988(H1N1))]
Length=566

 Score = 1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAY56898.1|  hemagglutinin [Influenza A virus (A/swine/Guangdong/2/01(H1N1))]
 gb|ACA25338.1|  hemagglutinin [Influenza A virus (A/swine/Shanghai/2/2005(H1N1))]
Length=566

 Score = 1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILV LLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVFLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFE+FPK+SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEMFPKSSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TSADQQSLYQNADAYVFVGSS+Y+KKF+PEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSADQQSLYQNADAYVFVGSSKYNKKFRPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  TGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKST LR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTNLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDG LD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGLLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESV+NGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVRNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF87276.1|AF222028_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/163/97(H1N1))]
 gb|AAF87279.1|AF222031_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/168/97(H1N1))]
 gb|AAF87282.1|AF222034_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/457/98(H1N1))]
Length=566

 Score = 1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIASRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRM+YYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMDYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID +TNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGVTNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            L+L+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LILLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAA19934.1|  hemagglutinin [Influenza A virus (A/swine/St-Hyacinthe/106/1991(H1))]
Length=566

 Score = 1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECESLST SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECESLSTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+G TAACP+AGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGTTAACPYAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHPSTS +QQSLYQNAD YVFVGSS+Y+KKFKPEIA RPKVRDQ
Sbjct  181  SYVNNKGKEVLVLWGIHHPSTSNEQQSLYQNADTYVFVGSSKYNKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQN+HP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNVHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYH+CDN CMESVKNGTYDYPKYSEE++LNREEIDG+KL+STRIYQILAIYSTVASS
Sbjct  481  CFEFYHRCDNACMESVKNGTYDYPKYSEESRLNREEIDGIKLDSTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>sp|P26140.1|HEMA_I88A6  RecName: Full=Hemagglutinin; Contains: RecName: Full=Hemagglutinin 
HA1 chain; Contains: RecName: Full=Hemagglutinin HA2 chain; 
Flags: Precursor
 pir||HMIV17  hemagglutinin precursor - influenza A virus (strain A/Swine/ 
Indiana/1726/88 [H1N1])
 gb|ABF71860.1|  haemagglutinin [Influenza A virus (A/Swine/Indiana/1726/1988(H1N1))]
Length=566

 Score = 1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/566 (92%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYP YSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPNYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLSVSLGAISFWMCSNGSLQCRICI  566


>gb|ABS50121.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/31483/1988(H1N1))]
Length=566

 Score = 1110 bits (2870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNA+D ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAVDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLN+KVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNRKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR29605.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/3/1985(H1N1))]
 gb|ABR29615.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/1/1985(H1N1))]
 gb|ABW86596.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/2/1985(H1N1))]
Length=566

 Score = 1110 bits (2870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABS50111.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/1/1987(H1N1))]
Length=566

 Score = 1109 bits (2868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTP+
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPE  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST+ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTIASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABK57092.1|  hemagglutinin [Influenza A virus (A/Philippines/344/2004(H1N2))]
Length=566

 Score = 1109 bits (2868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKA LVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKATLVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TA SWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLLTARSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWL KKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLTKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVG+S+Y+KKF PEIA RPKVRDQ
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGTSKYNKKFNPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGIIISD PVHDCNTTCQTP+
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDAPVHDCNTTCQTPR  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQN+HP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNVHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLN+KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNRKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYP+YSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPRYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF87278.1|AF222030_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/166/97(H1N1))]
Length=566

 Score = 1109 bits (2868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIASRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRM+YYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMDYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID +TNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGVTNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENER LDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERALDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            L+L+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LILLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL87869.1|AF455679_1  hemagglutinin [Influenza A virus (A/Swine/Iowa/930/01(H1N2))]
Length=566

 Score = 1108 bits (2867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILVVLLYTFTTADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD+NKGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHDTNKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKRFKPEIAERPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVN VIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNPVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF87277.1|AF222029_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/164/97(H1N1))]
Length=566

 Score = 1108 bits (2867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/566 (92%), Positives = 550/566 (97%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWP+H++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPDHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIASRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRM+YYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMDYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID +TNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGVTNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            L+L+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LILLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAN46827.1|  hemagglutinin [Influenza A virus (A/Swine/Korea/CY02/02(H1N2))]
Length=566

 Score = 1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/566 (92%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILVVLLYTFTTADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD+NKGVTAACPHAGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKVNSWPNHDTNKGVTAACPHAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YS++FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQALYQNADAYVFVGSSKYSRRFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQS+GLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSKGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSV+EKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVVEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IEGLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABB86946.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/11112/04(H1N1))]
Length=566

 Score = 1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECESLST SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECESLSTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+G TAACP+AGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGTTAACPYAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHPSTS +QQSLYQNAD YVFVGSS+Y+KKFKPEIA RPKVRDQ
Sbjct  181  SYVNNKGKEVLVLWGIHHPSTSNEQQSLYQNADTYVFVGSSKYNKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQN+HP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNVHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+ CMESVKNGTYDYPKYSEE++LNREEIDG+KL+STRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDACMESVKNGTYDYPKYSEESRLNREEIDGIKLDSTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
             VL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  SVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABV25638.1|  hemagglutinin [Influenza A virus (A/swine/Minnesota/37866/1999(H1N1))]
Length=566

 Score = 1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLY F TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILVVLLYAFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEEKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGWILGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWILGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPN+++++GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNYETSRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPSTS DQQSLYQNADAYVFVGSS+YSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKEKEVLVLWGIHHPSTSTDQQSLYQNADAYVFVGSSKYSKKFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDT VHDCNT CQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTSVHDCNTNCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKS KLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSKKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQ+AID ITNKVNS+IEKMN+QFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQSAIDGITNKVNSIIEKMNSQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLN+KVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNRKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLEST +YQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTEVYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABV25640.1|  hemagglutinin [Influenza A virus (A/swine/North Carolina/36883/2002(H1N1))]
Length=566

 Score = 1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/566 (92%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MK ILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKTILVVLLYTFTTADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD++KGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHDTDKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKEFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDKPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL29712.1|  hemagglutinin [Influenza A virus (A/SW/MO/1877/01(H1N2))]
Length=566

 Score = 1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/566 (92%), Positives = 549/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILVVLLYTFTTADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD+NKGVTAACP+AGA SFY+NLIWLVKKG+SYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHDTNKGVTAACPYAGASSFYRNLIWLVKKGDSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSNDQQTLYQNADAYVFVGSSKYSKRFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNS+IEKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSIIEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENE+TLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENEKTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAR90881.2|  hemagglutinin [Influenza A virus (A/swine/Pingtung/92-2/2003(H1N2))]
Length=566

 Score = 1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/566 (90%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF  ANADTLCIGYHANNSTDTVDT+LEKN+TVTHSVNLLEDKHNGKLCK
Sbjct  1    MKAILVVLLYTFTAANADTLCIGYHANNSTDTVDTLLEKNITVTHSVNLLEDKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TA SWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGMAPLHLGKCNIAGWLLGNPECEPLFTAKSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++NKGVTAACPHAGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNKGVTAACPHAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHPSTS DQQSLYQNADAYVFVGSS+Y+KK KPEIA RPKVRDQ
Sbjct  181  SYVNNKGKEVLVLWGIHHPSTSNDQQSLYQNADAYVFVGSSKYNKKLKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GR+NYYWTLVEPGD ITFEATGNL+VPRYAFAM R++GSGIIISD PVHDCN TCQTPK
Sbjct  241  AGRINYYWTLVEPGDTITFEATGNLIVPRYAFAMNRDSGSGIIISDAPVHDCNATCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTS PFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSHPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSG+AAD KSTQNAID ITNK+NSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGFAADRKSTQNAIDGITNKINSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            +ENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  VENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCDNTCMESVKNGTYDYP+YSEE+KLNREEI+GVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDNTCMESVKNGTYDYPRYSEESKLNREEIEGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACA25337.1|  hemagglutinin [Influenza A virus (A/swine/Shanghai/1/2005(H1N1))]
Length=566

 Score = 1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/566 (92%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTFA A ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYTFAAAKADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFE+FPK+SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEMFPKSSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHP TSADQQSLYQNADAYVFVGSS+Y+KKF+PEIA RPKVR Q
Sbjct  181  SYINNKEKEVLVLWGIHHPPTSADQQSLYQNADAYVFVGSSKYNKKFRPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  TGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKST LR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTNLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDG LD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGLLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESV+NGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVRNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGA+SFWMCSNGSLQCRI I
Sbjct  541  LVLLVSLGAVSFWMCSNGSLQCRIYI  566


>gb|AAF87275.1|AF222027_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/136/97(H1N1))]
Length=566

 Score = 1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE++HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L+GVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LKGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK +SWPNH++N+GVT+ACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKANSWPNHETNRGVTSACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKF PEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPPTSNDQQSLYQNADAYVFVGSSKYNKKFMPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLV PRYAFAMER +GSGIIISDTPVHDCN TCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVAPRYAFAMERGSGSGIIISDTPVHDCNATCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINT+LPFQNIHP+TIG+CPKYVKST+LR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTNLPFQNIHPVTIGECPKYVKSTRLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMES+KNGTYDYPKYSEEAKL REEIDGVKLESTRIYQILAIYST+ASS
Sbjct  481  CFEFYHKCDDTCMESIKNGTYDYPKYSEEAKLTREEIDGVKLESTRIYQILAIYSTIASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABX58646.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/2/1987(H1N1))]
Length=566

 Score = 1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/566 (91%), Positives = 547/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQN+HP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNVHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKL+STRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLDSTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF87283.1|AF222035_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/458/98(H1N1))]
Length=566

 Score = 1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/566 (91%), Positives = 547/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLY F TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYAFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L+GVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LKGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVT+ACP++GA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTSACPYSGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKF PEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFMPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLV PRYAFAMER +GSGIIISDTPV+DCNT CQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVAPRYAFAMERGSGSGIIISDTPVYDCNTACQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYA D KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAPDRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFL++WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLNVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEA+LNREEIDGVKLESTRIYQILAIYST+ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEARLNREEIDGVKLESTRIYQILAIYSTIASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77928.1|  hemagglutinin [Influenza A virus (A/swine/Korea/CAS08/2005(H1N1))]
Length=566

 Score = 1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTFATA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILVVLLYTFATADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD++KGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHDTDKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKRFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAF M+R +GSGII+SD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFPMKRGSGSGIIVSDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNS+IEKMNTQFTAVGKEF+ LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSIIEKMNTQFTAVGKEFSQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL29715.1|  hemagglutinin [Influenza A virus (A/SW/MN/17138/01(H1N2))]
Length=566

 Score = 1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/566 (91%), Positives = 547/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+V LYTF  ANADTLCIGYHANNST+TVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVSLYTFTAANADTLCIGYHANNSTETVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYP LSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPTLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP T+ DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTNTDQQSLYQNADAYVFVGSSKYNKKFKPEIAPRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTP+HDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPIHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAADLKSTQNAID IT KVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADLKSTQNAIDGITTKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMES+KNG YDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESIKNGIYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL29709.1|  hemagglutinin [Influenza A virus (A/SW/CO/17871/01(H1N2))]
Length=566

 Score = 1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/566 (91%), Positives = 547/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNH++NKGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHETNKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKRFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLV PRYAFAM+R +GSGI+ISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVAPRYAFAMKRGSGSGIVISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQ+AID ITNKVNSVIEKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQSAIDGITNKVNSVIEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABV25643.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/00239/2004(H1N1))]
Length=566

 Score = 1102 bits (2851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAI+VVLLYTFATA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KH+GKLCK
Sbjct  1    MKAIIVVLLYTFATADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHDGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD+NKGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHDTNKGVTAACPYAGASSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKRFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRM+YYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGII+SD PVHDCNTTCQTPK
Sbjct  241  AGRMDYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIVSDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNS+IEKMNTQFTAVGKEF+ LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSIIEKMNTQFTAVGKEFSQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLES RIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESARIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGA+SFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAVSFWMCSNGSLQCRICI  566


>gb|ABD85123.1|  hemagglutinin [Influenza A virus (A/swine/Taiwan/CO935/2004(H1N2))]
 gb|ABD85261.1|  hemagglutinin [Influenza A virus (A/swine/Taiwan/CO935/2004(H1N2))]
Length=566

 Score = 1102 bits (2851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDT+LEKNVTVTHSVNLLEDKHNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTLLEKNVTVTHSVNLLEDKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECE L TA SWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECEPLFTAKSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++NKGVTAACP+AGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHPSTS DQQSLYQNADAYVFVGSS+Y+K+FKPEIA RPKVRDQ
Sbjct  181  SYVNNKGKEVLVLWGIHHPSTSNDQQSLYQNADAYVFVGSSKYNKRFKPEIATRPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNL+VPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLIVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTS PFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSHPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSG+AAD KSTQNAID ITNK+NSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGFAADRKSTQNAIDGITNKINSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            +ENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  VENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCDNTCMESVKNGTYDYP+YSEE+KLNREEI+GVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDNTCMESVKNGTYDYPRYSEESKLNREEIEGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVLVVSLGAISFWMCSNGSL  RICI
Sbjct  541  LVLVVSLGAISFWMCSNGSLHGRICI  566


>gb|AAO65612.1|  hemagglutinin [Influenza A virus (A/duck/NC/91347/01(H1N2))]
Length=566

 Score = 1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/566 (92%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MK ILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKTILVVLLYTFTTADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSV SFERFEIFPK +SWPNHD++KGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  HLSSVLSFERFEIFPKANSWPNHDTDKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKKFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM+R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDKPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAF87274.1|AF222026_1  hemagglutinin [Influenza A virus (A/Swine/Wisconsin/125/97(H1N1))]
Length=566

 Score = 1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE++HNGKLCK
Sbjct  1    MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L+GVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LKGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK +SWPNH++N+GVT+ACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKANSWPNHETNRGVTSACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKF PEIA RPKVR Q
Sbjct  181  SYINNKGKEVLVLWGIHHPPTSNDQQSLYQNADAYVFVGSSKYNKKFMPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLV PRYAFAMER +GSGIIISDTPVHDCN TCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVAPRYAFAMERGSGSGIIISDTPVHDCNATCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINT+LPFQNIHP+TIG+CPKYVKST+LR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTNLPFQNIHPVTIGECPKYVKSTRLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            I+NLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IKNLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMES+KNGTYDYPKYSEEAKL REEIDGVKLESTRIYQILAIYST+ASS
Sbjct  481  CFEFYHKCDDTCMESIKNGTYDYPKYSEEAKLTREEIDGVKLESTRIYQILAIYSTIASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACI26329.1|  hemagglutinin [Influenza A virus (A/X-53A(Puerto Rico/8/1934-New 
Jersey/11/1976)(H1N1))]
Length=566

 Score = 1100 bits (2846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/566 (91%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNT CQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD +STQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQRSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28636.1|  hemagglutinin [Influenza A virus (A/swine/Minnesota/5892-7/1979(H1N1))]
Length=566

 Score = 1100 bits (2846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/566 (90%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACPHAGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPHAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQ+SLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQESLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDVPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLEST+IYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTKIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28713.1|  hemagglutinin [Influenza A virus (A/swine/Wisconsin/11/1980(H1N1))]
Length=566

 Score = 1100 bits (2845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTP+HDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPIHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYH+CD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHRCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABQ42448.1|  hemagglutinin [Influenza A virus (A/swine/Hainan/1/2005(H1N2))]
Length=566

 Score = 1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/566 (91%), Positives = 548/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLY F   NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYAFTRGNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+KGKEVLVLWGIHHPST+ DQQSLYQNAD YVFV +S+YSKKFKPEIA RPKVRDQ
Sbjct  181  SYINNKGKEVLVLWGIHHPSTNTDQQSLYQNADTYVFVVTSKYSKKFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRM+YYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVH+C+TTCQTPK
Sbjct  241  AGRMDYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHNCSTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDG LD+WTYNAELLVLLENERTLDYHDSNV+NLYEKVR+QLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGLLDVWTYNAELLVLLENERTLDYHDSNVRNLYEKVRNQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CF+FYHKCD+TCMESVKNGTYDYPKY+EEAKLNR+EIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFKFYHKCDDTCMESVKNGTYDYPKYTEEAKLNRKEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL29714.1|  hemagglutinin [Influenza A virus (A/SW/MN/34893/01(H1N2))]
Length=566

 Score = 1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/566 (91%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            M+AILVVLLYTF TANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MEAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+ PLHLGKCNIAGW+LGNPEC SL TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIDPLHLGKCNIAGWLLGNPECGSLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++NKGVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNKGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY N+  KEVLVLWGIHHPSTS DQQSLYQN DAYVFVGSS YSKKFKPEIA RPKVRDQ
Sbjct  181  SYTNNMEKEVLVLWGIHHPSTSTDQQSLYQNTDAYVFVGSSTYSKKFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISD  +HDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDASIHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIGKCPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGKCPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            MVDGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVN VIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MVDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNPVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEF HKCD+TCMESV+NGTYDYPKYSEEAKL+RE+IDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFCHKCDDTCMESVRNGTYDYPKYSEEAKLSREKIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            ++L+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  MILLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28658.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/4/1981(H1N1))]
 gb|ABW36355.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/6/1981(H1N1))]
Length=566

 Score = 1099 bits (2843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/566 (90%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSY+VETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYVVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTP+HDC+TTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMSRGSGSGIIISDTPIHDCDTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|AAL87868.1|AF455678_1  hemagglutinin [Influenza A virus (A/Swine/Minnesota/55551/00 
(H1N2))]
Length=566

 Score = 1099 bits (2843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/566 (91%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MK ILVVLLYTF TA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKTILVVLLYTFTTADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECESL  ASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECESLFEASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNHD++ GVTA+CP+AGAKSFY+NLIWLVKKG+SYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHDTDSGVTASCPYAGAKSFYRNLIWLVKKGSSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYINDK KEVLV+WGIHHP  S DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVRDQ
Sbjct  181  SYINDKKKEVLVIWGIHHPPNSTDQQTLYQNADAYVFVGSSKYSKRFKPEIAARPKVRDQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMTRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKL++ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLKMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFN LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABY81426.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/1/1986(H1N1))]
Length=566

 Score = 1099 bits (2842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/566 (91%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVT ACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTVACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNAD+YVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADSYVFVGSSKYNKKFKPEIATRPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTLVEPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTPVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLVEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAIN+SLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINSSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDY KYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYLKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABS49932.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/1/1981(H1N1))]
Length=566

 Score = 1099 bits (2842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/566 (90%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSY+VETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYVVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTP+HDC+TTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPIHDCDTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28614.1|  hemagglutinin [Influenza A virus (A/swine/Kentucky/1/1976(H1N1))]
 gb|ABV45838.1|  hemagglutinin [Influenza A virus (A/Wisconsin/301/1976(H1N1))]
 gb|ABX58668.1|  hemagglutinin [Influenza A virus (A/swine/Wisconsin/30747/1976(H1N1))]
 gb|ACK99410.1|  hemagglutinin [Influenza A virus (A/swine/Wisconsin/30954/1976(H1N1))]
Length=566

 Score = 1099 bits (2842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R  GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGPGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVI+KMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIKKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28537.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/10/1977(H1N1))]
Length=566

 Score = 1098 bits (2839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/566 (90%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFAVTNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSY+VETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYVVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R  GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGPGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVI+KMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIKKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABQ44394.1|  hemagglutinin [Influenza A virus (A/New Jersey/1976(H1N1))]
Length=566

 Score = 1098 bits (2839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/566 (91%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLLTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKK NSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKENSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNT CQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD +STQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQRSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLDIWTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACE77927.1|  hemagglutinin [Influenza A virus (A/swine/Korea/CAN01/2004(H1N1))]
Length=566

 Score = 1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/566 (90%), Positives = 547/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLYTFATA+ADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLE+KHNGKLCK
Sbjct  1    MKAILVVLLYTFATADADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLENKHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRG+APLHLGKCNIAGW+LGNPECESL TASSWSYIVET +SDNGTCYPGDFI+YEELRE
Sbjct  61   LRGIAPLHLGKCNIAGWLLGNPECESLVTASSWSYIVETPNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
             LSSVSSFERFEIFPK +SWPNH+++KGVTAACP+AGA SFY+NLIWLV+KGNSYPKLSK
Sbjct  121  HLSSVSSFERFEIFPKANSWPNHETDKGVTAACPYAGANSFYRNLIWLVQKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLV+WGIHHP TS DQQ+LYQNADAYVFVGSS+YSK+FKPEIA RPKVR Q
Sbjct  181  SYINNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFVGSSKYSKRFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAF M+R +GSGII+SD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFPMKRGSGSGIIVSDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNS+IEKMNTQFTAVGKEF+ LEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSIIEKMNTQFTAVGKEFSQLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IE+LN KVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
Sbjct  421  IESLNNKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABW36333.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/2/1981(H1N1))]
Length=566

 Score = 1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/566 (90%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSY+VETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYVVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNIGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTP+HDC+TTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMSRGSGSGIIISDTPIHDCDTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABW71503.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/2/1978(H1N1))]
Length=566

 Score = 1097 bits (2837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28647.1|  hemagglutinin [Influenza A virus (A/swine/Nebraska/123/1977(H1N1))]
Length=566

 Score = 1097 bits (2837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y+KKFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNKKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGI+ISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIVISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABW36344.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/3/1981(H1N1))]
Length=566

 Score = 1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/566 (90%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSY+VETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYVVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTP+HDC+TTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPIHDCDTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNRE+IDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREKIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABU80232.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/86/1977(H1N1))]
Length=566

 Score = 1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 546/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKA+L+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAMLLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+S+NGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSNNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHPSTS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPSTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP++IG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVSIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28669.1|  hemagglutinin [Influenza A virus (A/swine/Ontario/7/1981(H1N1))]
Length=566

 Score = 1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/566 (90%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLLYTF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLYTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISDTP+HDC+TTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDTPIHDCDTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIY ILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYYILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABY51204.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/4/1978(H1N1))]
Length=566

 Score = 1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQN+HP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNVHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABS49921.1|  hemagglutinin [Influenza A virus (A/swine/Iowa/1/1977(H1N1))]
Length=566

 Score = 1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/566 (90%), Positives = 545/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKE+LVLWGIHHPSTS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEILVLWGIHHPSTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGI+ISD PVHDCNT CQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGILISDAPVHDCNTKCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACQ42242.1|  hemagglutinin [Influenza A virus (A/Auckland/1/2009(H1N1))]
Length=524

 Score = 1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/524 (100%), Positives = 524/524 (100%), Gaps = 0/524 (0%)

Query  43   VTHSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS  102
            VTHSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
Sbjct  1    VTHSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS  60

Query  103  DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFY  162
            DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFY
Sbjct  61   DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFY  120

Query  163  KNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSR  222
            KNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSR
Sbjct  121  KNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSR  180

Query  223  YSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGI  282
            YSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGI
Sbjct  181  YSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGI  240

Query  283  IISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQ  342
            IISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQ
Sbjct  241  IISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQ  300

Query  343  SRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEK  402
            SRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEK
Sbjct  301  SRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEK  360

Query  403  MNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNL  462
            MNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNL
Sbjct  361  MNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNL  420

Query  463  YEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKL  522
            YEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKL
Sbjct  421  YEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKL  480

Query  523  ESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI  566
            ESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI
Sbjct  481  ESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI  524


>gb|ABR28581.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/82/1977(H1N1))]
 gb|ABU80221.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/84/1977(H1N1))]
 gb|ABU80243.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/87/1977(H1N1))]
 gb|ABU80254.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/88/1977(H1N1))]
Length=566

 Score = 1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TF  ANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP++IG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVSIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABU80410.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/48/1977(H1N1))]
 gb|ABW36322.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/23/1976(H1N1))]
Length=566

 Score = 1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAI +VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAIPLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABR28625.1|  hemagglutinin [Influenza A virus (A/swine/Minnesota/27/1976(H1N1))]
 gb|ABU80188.1|  hemagglutinin [Influenza A virus (A/swine/Minnesota/24/1975(H1N1))]
Length=566

 Score = 1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TFA  NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L G+APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGGIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPKTSSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKL+K
Sbjct  121  QLSSVSSFERFEIFPKTSSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLNK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNT CQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ACI48760.1|  hemagglutinin [Influenza A virus (A/swine/Shanghai/1/2007(H1N2))]
Length=566

 Score = 1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/566 (90%), Positives = 544/566 (96%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAILVVLLY F   NADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILVVLLYAFTRGNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            LRGVAPLHLGKCNIAGW+LGNPECE L TASSWSYIVETS+SDNGTCYPGDF +YEELRE
Sbjct  61   LRGVAPLHLGKCNIAGWLLGNPECELLFTASSWSYIVETSNSDNGTCYPGDFTNYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SYIN+K KEVLVLWGIHHPST+ DQQSLYQNAD YVFV +S+YS KFKP+IA RPKVR Q
Sbjct  181  SYINNKKKEVLVLWGIHHPSTNTDQQSLYQNADTYVFVATSKYSMKFKPKIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRM+YYWTLVEPGD ITFEATGNLVVPRYAFAM+R +GSGIIISDTPVH+C+TTCQTPK
Sbjct  241  AGRMDYYWTLVEPGDTITFEATGNLVVPRYAFAMKRGSGSGIIISDTPVHNCSTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQNEQGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNEQGSGYAADRKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDG LD+WTYNAELLVLLENERTLDYHDSNV+NLYEKVR+QLKNNAKEIGNG
Sbjct  421  IENLNKKVDDGLLDVWTYNAELLVLLENERTLDYHDSNVRNLYEKVRNQLKNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEEAKLNR+EIDGVKLESTRIYQILAIYSTVASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEEAKLNRKEIDGVKLESTRIYQILAIYSTVASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566


>gb|ABW86574.1|  hemagglutinin [Influenza A virus (A/swine/Tennessee/5/1978(H1N1))]
Length=566

 Score = 1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/566 (90%), Positives = 543/566 (95%), Gaps = 0/566 (0%)

Query  1    MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK  60
            MKAIL+VLL TF  ANADTLC+GYHANNSTDTVDTVLEKNVTVTHSVNLLED+HNGKLCK
Sbjct  1    MKAILLVLLCTFTAANADTLCVGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCK  60

Query  61   LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE  120
            L  +APLHLGKCNIAGW+LGNPECE L T SSWSYIVETS+SDNGTCYPGDFI+YEELRE
Sbjct  61   LGRIAPLHLGKCNIAGWLLGNPECELLFTVSSWSYIVETSNSDNGTCYPGDFINYEELRE  120

Query  121  QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK  180
            QLSSVSSFERFEIFPK SSWPNH++N+GVTAACP+AGA SFY+NLIWLVKKGNSYPKLSK
Sbjct  121  QLSSVSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSK  180

Query  181  SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ  240
            SY+N+KGKEVLVLWGIHHP TS DQQSLYQNADAYVFVGSS+Y++KFKPEIA RPKVR Q
Sbjct  181  SYVNNKGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQ  240

Query  241  EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK  300
             GRMNYYWTL+EPGD ITFEATGNLVVPRYAFAM R +GSGIIISD PVHDCNTTCQTPK
Sbjct  241  AGRMNYYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTTCQTPK  300

Query  301  GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG  360
            GAINTSLPFQNIHP+TIG+CPKYVKSTKLR+ATGLRN+PSIQSRGLFGAIAGFIEGGWTG
Sbjct  301  GAINTSLPFQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTG  360

Query  361  MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420
            M+DGWYGYHHQN QGSGYAAD KSTQNAID ITNKVNSVIEKMNTQFTAVGKEFNHLEKR
Sbjct  361  MIDGWYGYHHQNGQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKR  420

Query  421  IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG  480
            IENLNKKVDDGFLD+WTYNAELLVLLENERTLD+HDSNVKNLYEKVRSQL+NNAKEIGNG
Sbjct  421  IENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNG  480

Query  481  CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS  540
            CFEFYHKCD+TCMESVKNGTYDYPKYSEE+KLNREEIDGVKLESTRIYQILAIYST ASS
Sbjct  481  CFEFYHKCDDTCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTAASS  540

Query  541  LVLVVSLGAISFWMCSNGSLQCRICI  566
            LVL+VSLGAISFWMCSNGSLQCRICI
Sbjct  541  LVLLVSLGAISFWMCSNGSLQCRICI  566

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools