User:Michael Strong/H1N1/MP

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

MP1 Protein Structural Homolgy Model

MP2 Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 MP1, residues 23-60, 82% sequence identity to pdp template 2rlf

MP1 Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
MP1 L3P 227831763_A/California/05/2 1
MP1 H222R 237624333_A/swine/Alberta/O 1
MP1 A227T 229484039_A/Canada-ON/RV152 2

MP1 Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of MP1 Protein, 64 sequences

gi|227831794_A/Texas/05/2009        --LLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 48
gi|229396496_A/Ohio/07/2009         MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396473_A/New_York/19/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396457_A/Texas/06/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396369_A/New_York/11/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229368681_A/Denmark/513/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229462698_A/Valencia/GP4/20      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229462686_A/Castilla-La_Man      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536072_A/Texas/07/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536035_A/Minnesota/02/20      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229535831_A/California/14/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229598891_A/Texas/15/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229783372_A/Korea/01/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229892712_A/Canada-NS/RV153      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|237511767_A/Mexico/4604/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|237511788_A/Mexico/4108/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227831763_A/California/05/2      MSPLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229609550_A/Stockholm/28/20      --------TYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 42
gi|227831828_A/Texas/04/2009        ----TEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 46
gi|227831821_A/Texas/04/2009        ----TEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 46
gi|227809836_A/California/04/2      ----TEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 46
gi|237511782_A/Mexico/4482/200      ----TEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 46
gi|227977101_A/California/10/2      ---LTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 47
gi|237511779_A/Mexico/4486/200      ---LTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 47
gi|227977120_A/California/08/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536061_A/New_York/20/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|228481036_A/Auckland/3/2009      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396445_A/New_York/15/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396359_A/New_York/06/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229484033_A/Canada-NS/RV153      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229462722_A/Castilla-La_Man      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229535981_A/Texas/08/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229535794_A/New_York/22/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536085_A/Indiana/09/2009      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536019_A/Arizona/01/2009      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229783379_A/New_York/1669/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229892728_A/Canada-ON/RV152      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229892722_A/Canada-AB/RV153      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|237511761_A/Mexico/4115/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|237511785_A/Mexico/4603/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229892725_A/Canada-NS/RV153      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229892719_A/Mexico/InDRE411      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229783400_A/New_York/1682/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536046_A/Arizona/02/2009      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229536118_A/Michigan/02/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229535994_A/South_Carolina/      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229535813_A/Texas/09/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229462710_A/Pais_Vasco/GP20      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229484036_A/Mexico/InDRE448      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396429_A/New_York/10/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396383_A/New_York/18/200      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|228481039_A/Auckland/2/2009      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229396489_A/Ohio/07/2009         MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227977152_A/California/08/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227977108_A/California/04/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227831780_A/California/06/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227977140_A/California/07/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227977164_A/California/07/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|227831803_A/California/09/2      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229299525_A/Texas/04/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229299505_A/Texas/05/2009        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|237624333_A/swine/Alberta/O      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229484039_A/Canada-ON/RV152      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
gi|229892716_A/Canada-ON/RV152      MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
                                            ******************************************

gi|227831794_A/Texas/05/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 98
gi|229396496_A/Ohio/07/2009         ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396473_A/New_York/19/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396457_A/Texas/06/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396369_A/New_York/11/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229368681_A/Denmark/513/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229462698_A/Valencia/GP4/20      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229462686_A/Castilla-La_Man      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536072_A/Texas/07/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536035_A/Minnesota/02/20      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229535831_A/California/14/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229598891_A/Texas/15/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229783372_A/Korea/01/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229892712_A/Canada-NS/RV153      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|237511767_A/Mexico/4604/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|237511788_A/Mexico/4108/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227831763_A/California/05/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229609550_A/Stockholm/28/20      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 92
gi|227831828_A/Texas/04/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 96
gi|227831821_A/Texas/04/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 96
gi|227809836_A/California/04/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 96
gi|237511782_A/Mexico/4482/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 96
gi|227977101_A/California/10/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 97
gi|237511779_A/Mexico/4486/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 97
gi|227977120_A/California/08/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536061_A/New_York/20/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|228481036_A/Auckland/3/2009      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396445_A/New_York/15/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396359_A/New_York/06/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229484033_A/Canada-NS/RV153      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229462722_A/Castilla-La_Man      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229535981_A/Texas/08/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229535794_A/New_York/22/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536085_A/Indiana/09/2009      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536019_A/Arizona/01/2009      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229783379_A/New_York/1669/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229892728_A/Canada-ON/RV152      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229892722_A/Canada-AB/RV153      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|237511761_A/Mexico/4115/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|237511785_A/Mexico/4603/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229892725_A/Canada-NS/RV153      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229892719_A/Mexico/InDRE411      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229783400_A/New_York/1682/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536046_A/Arizona/02/2009      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229536118_A/Michigan/02/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229535994_A/South_Carolina/      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229535813_A/Texas/09/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229462710_A/Pais_Vasco/GP20      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229484036_A/Mexico/InDRE448      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396429_A/New_York/10/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396383_A/New_York/18/200      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|228481039_A/Auckland/2/2009      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229396489_A/Ohio/07/2009         ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227977152_A/California/08/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227977108_A/California/04/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227831780_A/California/06/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227977140_A/California/07/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227977164_A/California/07/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|227831803_A/California/09/2      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229299525_A/Texas/04/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229299505_A/Texas/05/2009        ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|237624333_A/swine/Alberta/O      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229484039_A/Canada-ON/RV152      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
gi|229892716_A/Canada-ON/RV152      ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY 100
                                    **************************************************

gi|227831794_A/Texas/05/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 148
gi|229396496_A/Ohio/07/2009         KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396473_A/New_York/19/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396457_A/Texas/06/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396369_A/New_York/11/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229368681_A/Denmark/513/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229462698_A/Valencia/GP4/20      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229462686_A/Castilla-La_Man      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536072_A/Texas/07/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536035_A/Minnesota/02/20      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229535831_A/California/14/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229598891_A/Texas/15/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229783372_A/Korea/01/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229892712_A/Canada-NS/RV153      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|237511767_A/Mexico/4604/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|237511788_A/Mexico/4108/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227831763_A/California/05/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229609550_A/Stockholm/28/20      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 142
gi|227831828_A/Texas/04/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 146
gi|227831821_A/Texas/04/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 146
gi|227809836_A/California/04/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 146
gi|237511782_A/Mexico/4482/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 146
gi|227977101_A/California/10/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 147
gi|237511779_A/Mexico/4486/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 147
gi|227977120_A/California/08/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536061_A/New_York/20/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|228481036_A/Auckland/3/2009      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396445_A/New_York/15/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396359_A/New_York/06/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229484033_A/Canada-NS/RV153      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229462722_A/Castilla-La_Man      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229535981_A/Texas/08/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229535794_A/New_York/22/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536085_A/Indiana/09/2009      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536019_A/Arizona/01/2009      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229783379_A/New_York/1669/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229892728_A/Canada-ON/RV152      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229892722_A/Canada-AB/RV153      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|237511761_A/Mexico/4115/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|237511785_A/Mexico/4603/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229892725_A/Canada-NS/RV153      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229892719_A/Mexico/InDRE411      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229783400_A/New_York/1682/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536046_A/Arizona/02/2009      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229536118_A/Michigan/02/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229535994_A/South_Carolina/      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229535813_A/Texas/09/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229462710_A/Pais_Vasco/GP20      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229484036_A/Mexico/InDRE448      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396429_A/New_York/10/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396383_A/New_York/18/200      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|228481039_A/Auckland/2/2009      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229396489_A/Ohio/07/2009         KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227977152_A/California/08/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227977108_A/California/04/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227831780_A/California/06/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227977140_A/California/07/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227977164_A/California/07/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|227831803_A/California/09/2      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229299525_A/Texas/04/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229299505_A/Texas/05/2009        KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|237624333_A/swine/Alberta/O      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229484039_A/Canada-ON/RV152      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
gi|229892716_A/Canada-ON/RV152      KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT 150
                                    **************************************************

gi|227831794_A/Texas/05/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 198
gi|229396496_A/Ohio/07/2009         CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396473_A/New_York/19/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396457_A/Texas/06/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396369_A/New_York/11/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229368681_A/Denmark/513/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229462698_A/Valencia/GP4/20      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229462686_A/Castilla-La_Man      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536072_A/Texas/07/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536035_A/Minnesota/02/20      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229535831_A/California/14/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229598891_A/Texas/15/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229783372_A/Korea/01/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229892712_A/Canada-NS/RV153      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|237511767_A/Mexico/4604/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|237511788_A/Mexico/4108/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227831763_A/California/05/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229609550_A/Stockholm/28/20      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 192
gi|227831828_A/Texas/04/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 196
gi|227831821_A/Texas/04/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 196
gi|227809836_A/California/04/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 196
gi|237511782_A/Mexico/4482/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 196
gi|227977101_A/California/10/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 197
gi|237511779_A/Mexico/4486/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 197
gi|227977120_A/California/08/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536061_A/New_York/20/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|228481036_A/Auckland/3/2009      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396445_A/New_York/15/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396359_A/New_York/06/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229484033_A/Canada-NS/RV153      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229462722_A/Castilla-La_Man      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229535981_A/Texas/08/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229535794_A/New_York/22/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536085_A/Indiana/09/2009      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536019_A/Arizona/01/2009      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229783379_A/New_York/1669/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229892728_A/Canada-ON/RV152      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229892722_A/Canada-AB/RV153      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|237511761_A/Mexico/4115/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|237511785_A/Mexico/4603/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229892725_A/Canada-NS/RV153      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229892719_A/Mexico/InDRE411      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229783400_A/New_York/1682/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536046_A/Arizona/02/2009      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229536118_A/Michigan/02/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229535994_A/South_Carolina/      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229535813_A/Texas/09/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229462710_A/Pais_Vasco/GP20      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229484036_A/Mexico/InDRE448      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396429_A/New_York/10/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396383_A/New_York/18/200      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|228481039_A/Auckland/2/2009      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229396489_A/Ohio/07/2009         CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227977152_A/California/08/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227977108_A/California/04/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227831780_A/California/06/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227977140_A/California/07/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227977164_A/California/07/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|227831803_A/California/09/2      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229299525_A/Texas/04/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229299505_A/Texas/05/2009        CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|237624333_A/swine/Alberta/O      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229484039_A/Canada-ON/RV152      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
gi|229892716_A/Canada-ON/RV152      CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA 200
                                    **************************************************

gi|227831794_A/Texas/05/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 248
gi|229396496_A/Ohio/07/2009         EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396473_A/New_York/19/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396457_A/Texas/06/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396369_A/New_York/11/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229368681_A/Denmark/513/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229462698_A/Valencia/GP4/20      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229462686_A/Castilla-La_Man      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536072_A/Texas/07/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536035_A/Minnesota/02/20      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229535831_A/California/14/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229598891_A/Texas/15/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229783372_A/Korea/01/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229892712_A/Canada-NS/RV153      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|237511767_A/Mexico/4604/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|237511788_A/Mexico/4108/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227831763_A/California/05/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229609550_A/Stockholm/28/20      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 242
gi|227831828_A/Texas/04/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 246
gi|227831821_A/Texas/04/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 246
gi|227809836_A/California/04/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 246
gi|237511782_A/Mexico/4482/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 246
gi|227977101_A/California/10/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 247
gi|237511779_A/Mexico/4486/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 247
gi|227977120_A/California/08/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536061_A/New_York/20/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|228481036_A/Auckland/3/2009      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396445_A/New_York/15/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396359_A/New_York/06/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229484033_A/Canada-NS/RV153      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229462722_A/Castilla-La_Man      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229535981_A/Texas/08/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229535794_A/New_York/22/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536085_A/Indiana/09/2009      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536019_A/Arizona/01/2009      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229783379_A/New_York/1669/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229892728_A/Canada-ON/RV152      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229892722_A/Canada-AB/RV153      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|237511761_A/Mexico/4115/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|237511785_A/Mexico/4603/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229892725_A/Canada-NS/RV153      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229892719_A/Mexico/InDRE411      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229783400_A/New_York/1682/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536046_A/Arizona/02/2009      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229536118_A/Michigan/02/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229535994_A/South_Carolina/      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229535813_A/Texas/09/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229462710_A/Pais_Vasco/GP20      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229484036_A/Mexico/InDRE448      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396429_A/New_York/10/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396383_A/New_York/18/200      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|228481039_A/Auckland/2/2009      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229396489_A/Ohio/07/2009         EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227977152_A/California/08/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227977108_A/California/04/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227831780_A/California/06/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227977140_A/California/07/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227977164_A/California/07/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|227831803_A/California/09/2      EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229299525_A/Texas/04/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229299505_A/Texas/05/2009        EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|237624333_A/swine/Alberta/O      EAMEVANQTRQMVHAMRTIGTRPSSSAGLKDDLLENLQAYQKRMGVQMQR 250
gi|229484039_A/Canada-ON/RV152      EAMEVANQTRQMVHAMRTIGTHPSSSTGLKDDLLENLQAYQKRMGVQMQR 250
gi|229892716_A/Canada-ON/RV152      EAMEVANQTRQMVHAMRTIGTHPSSSTGLKDDLLENLQAYQKRMGVQMQR 250
                                    *********************:****:***********************

gi|227831794_A/Texas/05/2009        FK 250
gi|229396496_A/Ohio/07/2009         FK 252
gi|229396473_A/New_York/19/200      FK 252
gi|229396457_A/Texas/06/2009        FK 252
gi|229396369_A/New_York/11/200      FK 252
gi|229368681_A/Denmark/513/200      FK 252
gi|229462698_A/Valencia/GP4/20      FK 252
gi|229462686_A/Castilla-La_Man      FK 252
gi|229536072_A/Texas/07/2009        FK 252
gi|229536035_A/Minnesota/02/20      FK 252
gi|229535831_A/California/14/2      FK 252
gi|229598891_A/Texas/15/2009        FK 252
gi|229783372_A/Korea/01/2009        FK 252
gi|229892712_A/Canada-NS/RV153      FK 252
gi|237511767_A/Mexico/4604/200      FK 252
gi|237511788_A/Mexico/4108/200      FK 252
gi|227831763_A/California/05/2      FK 252
gi|229609550_A/Stockholm/28/20      FK 244
gi|227831828_A/Texas/04/2009        FK 248
gi|227831821_A/Texas/04/2009        FK 248
gi|227809836_A/California/04/2      FK 248
gi|237511782_A/Mexico/4482/200      FK 248
gi|227977101_A/California/10/2      FK 249
gi|237511779_A/Mexico/4486/200      FK 249
gi|227977120_A/California/08/2      FK 252
gi|229536061_A/New_York/20/200      FK 252
gi|228481036_A/Auckland/3/2009      FK 252
gi|229396445_A/New_York/15/200      FK 252
gi|229396359_A/New_York/06/200      FK 252
gi|229484033_A/Canada-NS/RV153      FK 252
gi|229462722_A/Castilla-La_Man      FK 252
gi|229535981_A/Texas/08/2009        FK 252
gi|229535794_A/New_York/22/200      FK 252
gi|229536085_A/Indiana/09/2009      FK 252
gi|229536019_A/Arizona/01/2009      FK 252
gi|229783379_A/New_York/1669/2      FK 252
gi|229892728_A/Canada-ON/RV152      FK 252
gi|229892722_A/Canada-AB/RV153      FK 252
gi|237511761_A/Mexico/4115/200      FK 252
gi|237511785_A/Mexico/4603/200      FK 252
gi|229892725_A/Canada-NS/RV153      FK 252
gi|229892719_A/Mexico/InDRE411      FK 252
gi|229783400_A/New_York/1682/2      FK 252
gi|229536046_A/Arizona/02/2009      FK 252
gi|229536118_A/Michigan/02/200      FK 252
gi|229535994_A/South_Carolina/      FK 252
gi|229535813_A/Texas/09/2009        FK 252
gi|229462710_A/Pais_Vasco/GP20      FK 252
gi|229484036_A/Mexico/InDRE448      FK 252
gi|229396429_A/New_York/10/200      FK 252
gi|229396383_A/New_York/18/200      FK 252
gi|228481039_A/Auckland/2/2009      FK 252
gi|229396489_A/Ohio/07/2009         FK 252
gi|227977152_A/California/08/2      FK 252
gi|227977108_A/California/04/2      FK 252
gi|227831780_A/California/06/2      FK 252
gi|227977140_A/California/07/2      FK 252
gi|227977164_A/California/07/2      FK 252
gi|227831803_A/California/09/2      FK 252
gi|229299525_A/Texas/04/2009        FK 252
gi|229299505_A/Texas/05/2009        FK 252
gi|237624333_A/swine/Alberta/O      FK 252
gi|229484039_A/Canada-ON/RV152      FK 252
gi|229892716_A/Canada-ON/RV152      FK 252
                                    **

MP1 BLAST


>gb|ACC94118.1|  matrix protein 1 [Influenza A virus (A/swine/Laer/IDT4126/05(H3N2))]
Length=252

 Score =  522 bits (1344),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 250/252 (99%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAC40043.1|  matrix protein 1 [Influenza A virus (A/Hong Kong/1774/99(H3N2))]
Length=252

 Score =  522 bits (1344),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 250/252 (99%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQM GSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMVGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACC94124.1|  matrix protein 1 [Influenza A virus (A/swine/Osterhofen/IDT4004/05(H3N2))]
Length=252

 Score =  521 bits (1342),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 249/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEW+KTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWVKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABB00338.1|  M1 protein [Influenza A virus (A/swine/Belzig/2/2001(H1N1))]
 gb|ABD62795.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/39139/2002(H3N2))]
 gb|ABE12635.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/51915/2003(H1N1))]
 32 more sequence titles
 gb|ABE27165.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/54008/2004(H3N2))]
 gb|ABK57098.1|  matrix protein [Influenza A virus (A/Thailand/271/2005(H1N1))]
 gb|ABO44036.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/42386/2002(H3N2))]
 gb|ABS53356.1|  M1 matrix protein [Influenza A virus (A/swine/Doetlingen/IDT4735/2005(H1N2))]
 gb|ACC94058.1|  matrix protein 1 [Influenza A virus (A/swine/Bissendorf/IDT1864/03(H3N2))]
 gb|ACC94060.1|  matrix protein 1 [Influenza A virus (A/swine/Ehren/IDT2570/03(H1N2))]
 gb|ACC94062.1|  matrix protein 1 [Influenza A virus (A/swine/Gescher/IDT2702/03(H3N2))]
 gb|ACC94064.1|  matrix protein 1 [Influenza A virus (A/swine/Haseluenne/2617/2003(H1N1))]
 gb|ACC94068.1|  matrix protein 1 [Influenza A virus (A/swine/IVD/IDT2674/03(H1N2))]
 gb|ACC94070.1|  matrix protein 1 [Influenza A virus (A/swine/Nordkirchen/IDT1993/2003(H3N2))]
 gb|ACC94076.1|  matrix protein 1 [Influenza A virus (A/swine/Vechta/2623/03(H1N1))]
 gb|ACC94080.1|  matrix protein 1 [Influenza A virus (A/swine/Waltersdorf/IDT2527/03(H1N2))]
 gb|ACC94082.1|  matrix protein 1 [Influenza A virus (A/swine/Damme/IDT2890/04(H3N2))]
 gb|ACC94084.1|  matrix protein 1 [Influenza A virus (A/swine/Geldern/IDT2888/2004(H1N1))]
 gb|ACC94088.1|  matrix protein 1 [Influenza A virus (A/swine/Greven/IDT2889/2004(H1N1))]
 gb|ACC94094.1|  matrix protein 1 [Influenza A virus (A/swine/Lohne/IDT3357/04(H3N2))]
 gb|ACC94096.1|  matrix protein 1 [Influenza A virus (A/swine/Nortrup/IDT3685/04(H1N2))]
 gb|ACC94098.1|  matrix protein 1 [Influenza A virus (A/swine/Seesen/IDT3055/04(H3N2))]
 gb|ACC94104.1|  matrix protein 1 [Influenza A virus (A/swine/Bad Griesbach/IDT4191/05(H3N2))]
 gb|ACC94106.1|  matrix protein 1 [Influenza A virus (A/swine/Doetlingen/IDT3780/05(H1N2))]
 gb|ACC94108.1|  matrix protein 1 [Influenza A virus (A/swine/Egglham/IDT5250/05(H3N2))]
 gb|ACC94114.1|  matrix protein 1 [Influenza A virus (A/swine/Krogel/IDT4192/05(H1N1))]
 gb|ACC94116.1|  matrix protein 1 [Influenza A virus (A/swine/Laer/IDT3893/2005(H1N2))]
 gb|ACC94120.1|  matrix protein 1 [Influenza A virus (A/swine/Merzen/IDT4114/05(H3N2))]
 gb|ACC94126.1|  matrix protein 1 [Influenza A virus (A/swine/Sprenge/IDT3805/05(H1N2))]
 gb|ACC94128.1|  matrix protein 1 [Influenza A virus (A/swine/Stadtlohn/IDT3853/05(H1N2))]
 gb|ACC94130.1|  matrix protein 1 [Influenza A virus (A/swine/Voglarn/IDT4096/05(H1N1))]
 gb|ACC94132.1|  matrix protein 1 [Influenza A virus (A/swine/Wohlerst/IDT4093/05(H1N1))]
 gb|ACJ06669.1|  matrix protein 1 [Influenza A virus (A/swine/Zhejiang/1/2007(H1N1))]
 dbj|BAH02064.1|  matrix protein 1 [Influenza A virus (A/swine/Chonburi/NIAH977/2004(H1N1))]
 gb|ACN67526.1|  matrix protein 1 [Influenza A virus (A/swine/Belgium/1/1998(H1N1))]
 gb|ACN72628.1|  matrix protein 1 [Influenza A virus (A/swine/Hungary/13509/2007(H3N2))]
Length=252

 Score =  520 bits (1339),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 249/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94074.1|  matrix protein 1 [Influenza A virus (A/swine/Norden/IDT2308/03(H1N2))]
Length=252

 Score =  519 bits (1337),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 249/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVAGQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94034.1|  matrix protein 1 [Influenza A virus (A/swine/Potsdam/1/81(H1N1))]
Length=252

 Score =  519 bits (1337),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABD78105.1|  matrix protein 1 [Influenza A virus (A/Swine/Spain/50047/2003(H1N1))]
Length=252

 Score =  519 bits (1336),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 249/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABB00354.1|  M1 protein [Influenza A virus (A/swine/Bakum/8602/99(H3N2))]
 gb|ACC94110.1|  matrix protein 1 [Influenza A virus (A/swine/Harkenblek/IDT4097/05(H3N2))]
Length=252

 Score =  519 bits (1336),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEW+KTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWVKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABD62834.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/33601/2001(H3N2))]
 gb|ACC94056.1|  matrix protein 1 [Influenza A virus (A/swine/Bakum/1769/03(H3N2))]
 dbj|BAH02074.1|  matrix protein 1 [Influenza A virus (A/swine/Chonburi/NIAH589/2005(H1N1))]
 dbj|BAH02084.1|  matrix protein 1 [Influenza A virus (A/swine/Chachoengsao/NIAH587/2005(H1N1))]
Length=252

 Score =  519 bits (1336),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMD+AVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94092.1|  matrix protein 1 [Influenza A virus (A/swine/Gudensberg/IDT2931/04(H1N2))]
Length=252

 Score =  519 bits (1336),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDR+VKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRSVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAP49200.1|  matrix protein 1 [Influenza A virus (A/swine/Germany/S043/2002(H3N2))]
Length=252

 Score =  518 bits (1335),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKA+IAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKADIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94134.1|  matrix protein 1 [Influenza A virus (A/swine/Bad Griesbach/IDT5604/06(H1N1))]
Length=252

 Score =  518 bits (1335),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHP+SSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPNSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94050.1|  matrix protein 1 [Influenza A virus (A/swine/Gent/7625/99(H1N2))]
Length=252

 Score =  518 bits (1334),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEA+EVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAIEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABS53366.1|  M1 matrix protein [Influenza A virus (A/swine/Cloppenburg/IDT4777/2005(H1N2))]
Length=252

 Score =  518 bits (1334),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAP49195.1|  matrix protein 1 [Influenza A virus (A/swine/Germany/SEk1178/2000(H1N2))]
Length=252

 Score =  518 bits (1334),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSS GLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSTGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94072.1|  matrix protein 1 [Influenza A virus (A/swine/Nordwalde/IDT2197/03(H1N2))]
 gb|ACC94078.1|  matrix protein 1 [Influenza A virus (A/swine/Visbek/IDT2869/03(H1N2))]
 gb|ACC94086.1|  matrix protein 1 [Influenza A virus (A/swine/Granstedt/IDT3475/04(H1N2))]
 gb|ACC94100.1|  matrix protein 1 [Influenza A virus (A/swine/Stolzenau/IDT3296/04(H1N2))]
Length=252

 Score =  518 bits (1333),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATT+NPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTSNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            +ASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  MASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|AAR12406.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/5190/99(H3N2))]
 gb|AAR12408.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/5200/99(H3N2))]
 gb|AAR12410.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/5212/99(H3N2))]
 gb|AAR12412.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/7982/00(H3N2))]
 gb|AAR12414.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/9296/01(H3N2))]
 gb|AAR12416.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/9745/01(H3N2))]
 gb|AAR12418.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/1144/02(H3N2))]
 gb|AAR12420.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/1197/02(H3N2))]
Length=249

 Score =  518 bits (1333),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 248/249 (99%), Positives = 248/249 (99%), Gaps = 0/249 (0%)

Query  4    LTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGILGFV  63
            LTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGILGFV
Sbjct  1    LTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGILGFV  60

Query  64   FTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGA  123
            FTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGA
Sbjct  61   FTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGA  120

Query  124  LASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLAS  183
            LASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLAS
Sbjct  121  LASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLAS  180

Query  184  TTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKR  243
            TTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKR
Sbjct  181  TTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKR  240

Query  244  MGVQMQRFK  252
            MGVQMQRFK
Sbjct  241  MGVQMQRFK  249


>dbj|BAH02054.1|  matrix protein 1 [Influenza A virus (A/swine/Chonburi/NIAH9469/2004(H1N1))]
Length=252

 Score =  518 bits (1333),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ++RFK
Sbjct  241  QKRMGVQIRRFK  252


>gb|ACC94066.1|  matrix protein 1 [Influenza A virus (A/swine/Loeningen/IDT2530/2003(H1N2))]
Length=252

 Score =  518 bits (1333),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIA+SQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIANSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABV45405.1|  M1 protein [Influenza A virus (A/swine/Thailand/KU7-2/2004(H3N2))]
Length=252

 Score =  518 bits (1333),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSII SGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIISSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABE27154.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/53207/2004(H1N1))]
Length=252

 Score =  517 bits (1332),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLE LMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEPLMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94052.1|  matrix protein 1 [Influenza A virus (A/swine/Berlin/1578/00(H3N2))]
Length=252

 Score =  517 bits (1332),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAA GLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAALGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94136.1|  matrix protein 1 [Influenza A virus (A/swine/Herzlake/IDT5335/06(H3N2))]
 gb|ACC94138.1|  matrix protein 1 [Influenza A virus (A/swine/Herzlake/IDT5336/06(H3N2))]
 gb|ACC94140.1|  matrix protein 1 [Influenza A virus (A/swine/Herzlake/IDT5337/06(H3N2))]
Length=252

 Score =  517 bits (1331),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEA+EVA+QTRQMVHAMR+IGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAIEVASQTRQMVHAMRSIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABB00340.1|  M1 protein [Influenza A virus (A/swine/Bakum/1832/00(H1N2))]
 gb|ABB00342.1|  M1 protein [Influenza A virus (A/swine/Bakum/1833/00(H1N2))]
 gb|ACC94090.1|  matrix protein 1 [Influenza A virus (A/swine/Gudensberg/IDT2930/04(H1N2))]
Length=252

 Score =  517 bits (1331),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDR+VKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRSVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAA81465.1|  Matrix Protein [Influenza A virus (A/turkey/Germany/3/91(H1N1))]
 gb|ABB00348.1|  M1 protein [Influenza A virus (A/swine/Leipzig/145/92(H3N2))]
 gb|ABB00350.1|  M1 protein [Influenza A virus (A/swine/Jena/5/96(H3N2))]
 21 more sequence titles
 gb|ABB00352.1|  M1 protein [Influenza A virus (A/swine/Lohne/1/97(H3N2))]
 emb|CAN89844.1|  matrix protein 1 [Influenza A virus (A/wild boar/Germany/WS169/2006(H3N2))]
 gb|ACC94040.1|  matrix protein 1 [Influenza A virus (A/swine/Gent/V230/1992(H1N1))]
 gb|ACC94042.1|  matrix protein 1 [Influenza A virus (A/swine/IDT/Re220/92(H3N2))]
 gb|ACC94044.1|  matrix protein 1 [Influenza A virus (A/swine/Bakum/909/93(H3N2))]
 gb|ACC94046.1|  matrix protein 1 [Influenza A virus (A/swine/England/17394/96(H1N2))]
 dbj|BAH02034.1|  matrix protein 1 [Influenza A virus (A/swine/Ratchaburi/NIAH1481/2000(H1N1))]
 dbj|BAH02044.1|  matrix protein 1 [Influenza A virus (A/swine/Ratchaburi/NIAH550/2003(H1N1))]
 dbj|BAH02104.1|  matrix protein 1 [Influenza A virus (A/swine/Chachoengsao/2003(H3N2))]
 dbj|BAH02114.1|  matrix protein 1 [Influenza A virus (A/swine/Udon Thani/NIAH464/2004(H3N2))]
 dbj|BAH02124.1|  matrix protein 1 [Influenza A virus (A/swine/Nakhon pathom/NIAH586-1/2005(H3N2))]
 emb|CAP49181.1|  matrix protein 1 [Influenza A virus (A/swine/Germany/Vi3161/95(H3N2))]
 emb|CAP49189.1|  matrix protein 1 [Influenza A virus (A/swine/Germany/SEC27/97(H3N2))]
 gb|ACO24997.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL10/1993(H1N1))]
 gb|ACO25008.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL11/1994(H1N1))]
 gb|ACO25018.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL12/1995(H1N1))]
 gb|ACO25039.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL14/1996(H1N1))]
 gb|ACO25050.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL15/1997(H1N1))]
 gb|ACO25072.1|  matrix protein 1 [Influenza A virus (A/swine/Scotland/WVL17/1999(H1N1))]
 gb|ACO25125.1|  matrix protein 1 [Influenza A virus (A/swine/Spain/WVL6/1991(H1N1))]
 gb|ACO25158.1|  matrix protein 1 [Influenza A virus (A/swine/Denmark/WVL9/1993(H1N1))]
Length=252

 Score =  516 bits (1330),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94054.1|  matrix protein 1 [Influenza A virus (A/swine/Belzig/54/01(H3N2))]
Length=252

 Score =  516 bits (1329),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAE AQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAERAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAC87394.1|  matrix protein 1 [Influenza A virus (A/swine/Cotes d'Armor/604/99(H1N2))]
Length=252

 Score =  516 bits (1329),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            M LLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MVLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>dbj|BAH02134.1|  matrix protein 1 [Influenza A virus (A/swine/Ratchaburi/NIAH59/2004(H3N2))]
Length=252

 Score =  516 bits (1329),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAME+A+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEIASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACL11955.1|  matrix protein 1 [Influenza A virus (A/swine/Thailand/KU5.1/2004(H3N2))]
Length=252

 Score =  516 bits (1328),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSII SGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIISSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQTR+MVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRRMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>dbj|BAH02094.1|  matrix protein 1 [Influenza A virus (A/swine/Saraburi/NIAH13021/2005(H1N2))]
 dbj|BAH02144.1|  matrix protein 1 [Influenza A virus (A/swine/Ratchaburi/NIAH874/2005(H3N2))]
Length=252

 Score =  516 bits (1328),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSII SGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIISSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACO25136.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL7/1992(H1N1))]
Length=252

 Score =  515 bits (1327),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAG+NTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGRNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAC40057.1|  matrix protein 1 [Influenza A virus (A/swine/Italy/1553-2/98(H3N2))]
Length=252

 Score =  515 bits (1327),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEV+TYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVDTYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94102.1|  matrix protein 1 [Influenza A virus (A/swine/Wedel/IDT2955/04(H1N1))]
Length=252

 Score =  515 bits (1326),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQ Y
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQVY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACO25147.1|  matrix protein 1 [Influenza A virus (A/swine/France/WVL8/1992(H1N1))]
Length=251

 Score =  515 bits (1326),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/251 (98%), Positives = 248/251 (98%), Gaps = 0/251 (0%)

Query  2    SLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGILG  61
            SLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGILG
Sbjct  1    SLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILG  60

Query  62   FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYST  121
            FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYST
Sbjct  61   FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYST  120

Query  122  GALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVL  181
            GALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVL
Sbjct  121  GALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVL  180

Query  182  ASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ  241
            ASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ
Sbjct  181  ASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ  240

Query  242  KRMGVQMQRFK  252
            KRMGVQ+QRFK
Sbjct  241  KRMGVQIQRFK  251


>sp|Q0A2G3.1|M1_I83A4  RecName: Full=Matrix protein 1; Short=M1
 gb|ABB00334.1|  M1 protein [Influenza A virus (A/swine/Schwerin/103/89(H1N1))]
 gb|ABI85118.1|  matrix protein 1 [Influenza A virus (A/turkey/Ireland/1378/1983(H5N8))]
 gb|ABV29591.1|  matrix protein 1 [Influenza A virus (A/swine/Italy/670/1987(H1N1))]
Length=252

 Score =  515 bits (1326),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACO25061.1|  matrix protein 1 [Influenza A virus (A/swine/England/WVL16/1998(H1N1))]
Length=252

 Score =  514 bits (1325),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMR IGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRAIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAC87396.1|  matrix protein 1 [Influenza A virus (A/swine/Italy/1521/98(H1N2))]
Length=252

 Score =  514 bits (1325),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMA TTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMAATTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAC87386.1|  matrix protein 1 [Influenza A virus (A/swine/Cotes d'Armor/1482/99(H1N1))]
Length=252

 Score =  514 bits (1324),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            M LLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MVLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACC94112.1|  matrix protein 1 [Influenza A virus (A/swine/Hertzen/IDT4317/05(H3N2))]
 gb|ACC94122.1|  matrix protein 1 [Influenza A virus (A/swine/Muesleringen-S./IDT4263/05(H3N2))]
Length=252

 Score =  514 bits (1323),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEV+TYVLSIIPSGPL AEIAQRLE VF GKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVDTYVLSIIPSGPLIAEIAQRLEGVFVGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|AAA43266.1|  M1 matrix protein [Influenza A virus (A/swine/Germany/2/1981(H1N1))]
 emb|CAC87410.1|  matrix protein 1 [Influenza A virus (A/Swine/Finistere/2899/82(H1N1))]
 gb|ABB00332.1|  M1 protein [Influenza A virus (A/swine/Potsdam/15/81(H1N1))]
 7 more sequence titles
 gb|ABB00344.1|  M1 protein [Influenza A virus (A/swine/Potsdam/35/82(H3N2))]
 gb|ABB00346.1|  M1 protein [Influenza A virus (A/swine/Karrenzien/2/87(H3N2))]
 gb|ACC94032.1|  matrix protein 1 [Influenza A virus (A/swine/Hannover/1/1981(H1N1))]
 gb|ACC94036.1|  matrix protein 1 [Influenza A virus (A/swine/Potsdam/268/81(H1N1))]
 gb|ACC94038.1|  matrix protein 1 [Influenza A virus (A/swine/Gent/1/84(H3N2))]
 gb|ACO25081.1|  matrix protein 1 [Influenza A virus (A/swine/Belgium/WVL2/1983(H1N1))]
 gb|ACO25103.1|  matrix protein 1 [Influenza A virus (A/swine/France/WVL4/1985(H1N1))]
Length=252

 Score =  513 bits (1322),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACC94048.1|  matrix protein 1 [Influenza A virus (A/swine/Bakum/1362/98(H3N2))]
Length=252

 Score =  513 bits (1322),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEV+TYVLSIIPSGPLKAEIAQRLE VFAGK+TDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVDTYVLSIIPSGPLKAEIAQRLEDVFAGKDTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABS89520.1|  matrix protein 1 [Influenza A virus (A/pekin duck/Italy/1848/2000(H7N1))]
Length=252

 Score =  513 bits (1322),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>emb|CAP49186.1|  matrix protein 1 [Influenza A virus (A/swine/Germany/Vi5698/1995(H1N1))]
Length=252

 Score =  513 bits (1321),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 246/252 (97%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEGAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGT PSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTRPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|AAL31412.1|  matrix protein [Influenza A virus (A/Goose/Hong Kong/ww26/2000(H5N1))]
 gb|AAL31413.1|  matrix protein [Influenza A virus (A/Goose/Hong Kong/ww28/2000(H5N1))]
 gb|AAT12048.1|  matrix protein [Influenza A virus (A/duck/Guangdong/07/2000(H5N1))]
 gb|AAT12056.1|  matrix protein [Influenza A virus (A/duck/Shanghai/08/2001(H5N1))]
Length=252

 Score =  513 bits (1321),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMV AMRTIGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVQAMRTIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABB18963.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/290/1978(H6N2))]
Length=252

 Score =  513 bits (1321),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQR+E VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRIEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACO25114.1|  matrix protein 1 [Influenza A virus (A/swine/Belgium/WVL5/1989(H1N1))]
Length=252

 Score =  513 bits (1321),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>emb|CAJ43165.1|  matrix protein 1 [Influenza A virus (A/turkey/France/87075/87(H1N1))]
Length=252

 Score =  513 bits (1321),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAME+A+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEIASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAU25848.1|  matrix protein 1 [Influenza A virus (A/swine/Saskatchewan/18789/02(H1N1))]
Length=252

 Score =  513 bits (1321),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABJ09507.1|  matrix protein 1 [Influenza A virus (A/goose/Fujian/bb/2003(H5N1))]
Length=252

 Score =  513 bits (1320),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHP+SSAGL+D+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPNSSAGLRDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABO77057.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/2984/2000(H7N1))]
Length=252

 Score =  513 bits (1320),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVP+ERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPNERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>sp|Q67202.1|M1_I85A4  RecName: Full=Matrix protein 1; Short=M1
 gb|AAA43336.1|  membrane protein M1 [Influenza virus type A (strain A/swine/Netherlands/12/85 
(H1N1))]
Length=252

 Score =  513 bits (1320),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ABB19619.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Alberta/141/1992(H1N1))]
 gb|ABG88202.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/171/1990(H1N1))]
 gb|ABJ90252.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/5093/99(H7N1))]
 7 more sequence titles
 gb|ABO52765.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4580/1999(H7N1))]
 gb|ABO77090.1|  matrix protein 1 [Influenza A virus (A/duck/Italy/551/2000(H7N1))]
 gb|ABR37375.1|  matrix protein 1 [Influenza A virus (A/guinea fowl/Italy/155/2000(H7N1))]
 gb|ABS89465.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4708/1999(H7N1))]
 gb|ABV01190.1|  matrix protein 1 [Influenza A virus (A/quail/Italy/4992/1999(H7N1))]
 gb|ABV01201.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/4789/1999(H7N1))]
 gb|ABV01223.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4617/1999(H7N1))]
Length=252

 Score =  512 bits (1319),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>emb|CAC87417.1|  matrix protein 1 [Influenza A virus (A/swine/Ille et Vilaine/1455/99(H1N1))]
Length=248

 Score =  512 bits (1319),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 245/248 (98%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  5    TEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVF  64
            TEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGILGFVF
Sbjct  1    TEVETYVLSIIPSGPLKAEIAQRLEGVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVF  60

Query  65   TLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGAL  124
            TLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGAL
Sbjct  61   TLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGAL  120

Query  125  ASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLAST  184
            ASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLAST
Sbjct  121  ASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLAST  180

Query  185  TAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRM  244
            TAKAMEQMAGSSEQAAEAMEVA+QTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRM
Sbjct  181  TAKAMEQMAGSSEQAAEAMEVASQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRM  240

Query  245  GVQMQRFK  252
            GVQ+QRFK
Sbjct  241  GVQIQRFK  248


>gb|ABI96773.1|  matrix protein 1 [Influenza A virus (A/chicken/Jiangsu/ng/2001(H9N2))]
Length=252

 Score =  512 bits (1318),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPIL+PLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILTPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMV AMRTIGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVQAMRTIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>sp|Q0A2H4.1|M1_I59A0  RecName: Full=Matrix protein 1; Short=M1
 gb|ABB20166.1|  matrix protein 1 [Influenza A virus (A/Duck/Nanchang/2-0486/2000(H2N9))]
 gb|ABB20176.1|  matrix protein 1 [Influenza A virus (A/Duck/Nanchang/4-184/2000(H2N9))]
 13 more sequence titles
 gb|ABB20263.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/342/1978(H5N2))]
 gb|ABB20273.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/205/1977(H5N3))]
 gb|ABB88153.1|  matrix protein 1 [Influenza A virus (A/chicken/Nanchang/7-010/2000(H3N6))]
 gb|ABB88163.1|  matrix protein 1 [Influenza A virus (A/quail/Nanchang/7-026/2000(H3N6))]
 gb|ABB88184.1|  matrix protein 1 [Influenza A virus (A/duck/Nanchang/1681/1992(H3N8))]
 gb|ABB88290.1|  matrix protein 1 [Influenza A virus (A/dk/Hong Kong/293/1978(H7N2))]
 gb|ABI85107.1|  matrix protein 1 [Influenza A virus (A/chicken/Scotland/1959(H5N1))]
 gb|ABQ84480.1|  matrix protein [Influenza A virus (A/duck/Hong Kong/23/1976(H5N3))]
 gb|ABQ84483.1|  matrix protein [Influenza A virus (A/duck/Hong Kong/342/1978(H5N2))]
 gb|ABQ84492.1|  matrix protein [Influenza A virus (A/duck/Jiang Xi/2374/2005(H3N6))]
 gb|ABQ84500.1|  matrix protein [Influenza A virus (A/mallard/Italy/36/2002(H5N3))]
 gb|ABY51504.1|  matrix protein 1 [Influenza A virus (A/duck/Victoria/1992(H3N8))]
 gb|ACF24970.1|  matrix protein 1 [Influenza A virus (A/turkey/MN/3689-1551/1982(H5N2))]
Length=252

 Score =  512 bits (1318),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABJ52565.1|  matrix protein 1 [Influenza A virus (A/chicken/Jilin/hl/2004(H5N1))]
Length=252

 Score =  512 bits (1318),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKRE+TFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREMTFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDL+ENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLIENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAK14989.1|AF231361_2  matrix protein 1 [Influenza A virus (A/black duck/New Jersey/1580/78(H2N3))]
Length=252

 Score =  511 bits (1317),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAA+AMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAKAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACO25092.1|  matrix protein 1 [Influenza A virus (A/swine/France/WVL3/1984(H1N1))]
Length=251

 Score =  511 bits (1317),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/251 (96%), Positives = 247/251 (98%), Gaps = 0/251 (0%)

Query  2    SLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGILG  61
            SLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGILG
Sbjct  1    SLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILG  60

Query  62   FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYST  121
            FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYST
Sbjct  61   FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYST  120

Query  122  GALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVL  181
            GALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMVL
Sbjct  121  GALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVL  180

Query  182  ASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ  241
            ASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ
Sbjct  181  ASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ  240

Query  242  KRMGVQMQRFK  252
            KRMGVQMQRFK
Sbjct  241  KRMGVQMQRFK  251


>gb|ABS49944.1|  matrix protein 1 [Influenza A virus (A/swine/Italy/671/1987(H1N1))]
Length=252

 Score =  511 bits (1317),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTR ILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRSILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>sp|Q0A435.1|M1_I56A2  RecName: Full=Matrix protein 1; Short=M1
 gb|ABI84546.1|  matrix protein 1 [Influenza A virus (A/duck/England/1/1956(H11N6))]
Length=252

 Score =  511 bits (1317),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRT+GTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTVGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABI98944.1|  matrix protein 1 [Influenza A virus (A/chicken/Jilin/xw/2003(H5N1))]
Length=252

 Score =  511 bits (1317),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMAT TNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATITNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHPSSSAGL+DDL+ENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPSSSAGLRDDLIENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABB00336.1|  M1 protein [Influenza A virus (A/swine/Bakum/5/95(H1N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERG QRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGQQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACO25029.1|  matrix protein 1 [Influenza A virus (A/swine/France/WVL13/1995(H1N1))]
Length=251

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/251 (96%), Positives = 247/251 (98%), Gaps = 0/251 (0%)

Query  2    SLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGILG  61
            SLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGILG
Sbjct  1    SLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILG  60

Query  62   FVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYST  121
            FVFTLTVPSERGLQRRRFVQNALNGNGDPNN+DRAVKLYKKLKREITFHGAKEV+LSYST
Sbjct  61   FVFTLTVPSERGLQRRRFVQNALNGNGDPNNIDRAVKLYKKLKREITFHGAKEVALSYST  120

Query  122  GALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVL  181
            GALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMVL
Sbjct  121  GALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVL  180

Query  182  ASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ  241
            ASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ
Sbjct  181  ASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQ  240

Query  242  KRMGVQMQRFK  252
            KRMGVQMQRFK
Sbjct  241  KRMGVQMQRFK  251


>gb|ACN72619.1|  matrix protein 1 [Influenza A virus (A/swine/Hungary/19774/2006(H1N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAG+NTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEGVFAGRNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMD+AVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
             GALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  PGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAG SEQAAEAMEVA+QTRQMVHAMRT+GTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGLSEQAAEAMEVASQTRQMVHAMRTVGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|ACA47464.1|  matrix protein 1 [Influenza A virus (A/chicken/Shantou/2535/2001(H5N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
             GALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  AGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMV AMRTIGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVQAMRTIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACA47409.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/195/2001(H5N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMV AMR IGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVQAMRAIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>ref|YP_308671.1|  M1 [Influenza A virus (A/Goose/Guangdong/1/96(H5N1))]
 sp|Q9Q0L8.1|M1_I96A0  RecName: Full=Matrix protein 1; Short=M1
 gb|AAD51928.1|AF144306_1  matrix protein 1; M1 [influenza A virus (A/Goose/Guangdong/1/96(H5N1))]
Length=252

 GENE ID: 3654621 M | M2 [Influenza A virus (A/Goose/Guangdong/1/96(H5N1))]
(10 or fewer PubMed links)

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAW78069.1|  matrix protein [Influenza A virus (A/duck/Korea/S17/03(H6N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAME+A+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEIASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAD25175.1|AF073182_1  matrix protein 1 [influenza A virus (A/Chicken/New York/4447-7/94 
(H7N2NSA))]
 gb|AAD25177.1|AF073183_1  matrix protein 1 [influenza A virus (A/Turkey/New York/4450-5/94 
(H7N2NSB))]
 gb|AAD25183.1|AF073186_1  matrix protein 1 [influenza A virus (A/Chicken/New York/19542-5/95 
(H7N2NSB))]
 12 more sequence titles
 gb|AAF70406.1|AF203788_1  matrix protein 1 [Influenza A virus (A/Chicken/Korea/MS96/96(H9N2))]
 gb|AAP57587.1|  membrane protein [Influenza A virus (A/ruddy turnstone/NJ/2242/00(H5N3))]
 gb|AAW78057.1|  matrix protein [Influenza A virus (A/chicken/Korea/S12/03(H9N2))]
 gb|AAY96440.1|  matrix protein [Influenza A virus (A/mallard/MN/182/98(H3N9))]
 gb|AAY96479.1|  matrix protein [Influenza A virus (A/ruddy turnstone/NJ/2242/00(H5N3))]
 gb|ABI84756.1|  matrix protein 1 [Influenza A virus (A/guinea fowl/New York/20221-11/1995(H2N2))]
 gb|ABI84766.1|  matrix protein 1 [Influenza A virus (A/guinea fowl/New York/13820-3/1995(H7N2))]
 gb|ABP49560.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/656/2002(Mixed))]
 gb|ABZ91686.1|  matrix protein 1 [Influenza A virus (A/domestic green-winged 
teal/Hunan/79/2005(H5N1))]
 gb|ACF08310.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/03188/2003(H9N2))]
 gb|ACF08312.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/03236/2003(H9N2))]
 emb|CAJ43177.1|  matrix protein 1 [Influenza A virus (A/mallard/France/2526/2001(H7N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAO46810.1|  matrix protein [Influenza A virus (A/Pheasant/HongKong/FY155/01-MB(H5N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEGAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABB18392.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/250/1978(H6N2))]
 gb|ABB18403.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/368/1978(H6N8))]
 gb|ABB18952.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/280/1978(H6N2))]
 gb|ABB18974.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/133/1978(H6N2))]
 gb|ABB18979.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/367/1978(H6N2))]
 gb|ABB19005.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/647/1978(H6N2))]
 gb|ABB19012.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/205/1978(H6N2))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQR+E VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRIEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM  TTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVATTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABO44146.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4479/2004(H7N3))]
 gb|ABO44190.1|  matrix protein 1 [Influenza A virus (A/quail/Italy/3347/2004(H7N3))]
 gb|ABO76991.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4608/2003(H7N3))]
 gb|ABO77013.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3337/2004(H7N3))]
 gb|ABY51526.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/9742/2002(H7N3))]
 gb|ACA04597.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4130/2004(H7N3))]
 gb|ACI16687.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/682/2003(H7N3))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 246/252 (97%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGAL SCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALTSCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>emb|CAC87390.1|  matrix protein 1 [Influenza A virus (A/swine/Cotes d'Armor/790/97(H1N2))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQ ALNGNGDPNNMD+AVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQTALNGNGDPNNMDKAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE  FGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVTFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>gb|AAY96493.1|  matrix protein [Influenza A virus (A/mallard/MN/355803/00(H6))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEGAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>emb|CAC84272.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/3461/99(H6N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHG+KEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGSKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAP49151.1|  matrix protein [Influenza A virus (A/Duck/Hong Kong/610/79(H9N2))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKRE+TFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREVTFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEGAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>sp|Q8QPI1.1|M1_I00A0  RecName: Full=Matrix protein 1; Short=M1
 gb|AAL31417.1|  matrix protein [Influenza A virus (A/Duck/Hong Kong/2986.1/2000(H5N1))]
 gb|AAL31418.1|  matrix protein [Influenza A virus (A/Goose/Hong Kong/3014.8/2000(H5N1))]
 6 more sequence titles
 gb|AAO46808.1|  matrix protein [Influenza A virus (A/Chicken/HongKong/FY150/01-MB(H5N1))]
 gb|AAT12053.1|  matrix protein [Influenza A virus (A/duck/Guangxi/22/2001(H5N1))]
 gb|ABP51966.1|  matrix protein 1 [Influenza A virus (A/goose/Viet Nam/113/2001(H5N1))]
 gb|ACA47420.1|  matrix protein 1 [Influenza A virus (A/chicken/Shantou/904/2001(H5N1))]
 gb|ACA47442.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/1437/2001(H5N1))]
 gb|ACA47453.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/1930/2001(H5N1))]
Length=252

 Score =  511 bits (1316),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHP+SSAGL+D+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPNSSAGLRDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>emb|CAC87404.1|  matrix protein 1 [Influenza A virus (A/swine/Italy/2034/99(H1N1))]
Length=252

 Score =  511 bits (1316),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 249/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            M LLTEVETYVLSIIPSGPLKAEIAQRLE+VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MVLLTEVETYVLSIIPSGPLKAEIAQRLENVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQ+ATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEGAFGLVCATCEQIADSQHRSHRQIATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAG+SEQAAEAME+A+Q RQMVHAMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGASEQAAEAMEIASQARQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQ+QRFK
Sbjct  241  QKRMGVQIQRFK  252


>sp|Q6J8C3.1|M1_I02A5  RecName: Full=Matrix protein 1; Short=M1
 gb|AAT39095.1|  matrix protein [Influenza A virus (A/Ck/HK/31.4/02 (H5N1))]
 gb|AAT39098.1|  matrix protein [Influenza A virus (A/Ck/HK/96.1/02 (H5N1))]
 gb|AAT39099.1|  matrix protein [Influenza A virus (A/Ck/HK/409.1/02 (H5N1))]
 gb|ACA47618.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/700/2002(H5N1))]
 gb|ACA47629.1|  matrix protein 1 [Influenza A virus (A/goose/Shantou/753/2002(H5N1))]
Length=252

 Score =  511 bits (1316),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMTTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHP+SSAGL+D+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPNSSAGLRDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABB19021.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/1040/1979(H6N5))]
 gb|ABB19027.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/1045/1979(H6N5))]
 gb|ABB19033.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/1081/1979(H6N5))]
 gb|ABB19043.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/1343/1979(H6N4))]
 gb|ABB19073.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/628/1979(H6N8))]
Length=252

 Score =  511 bits (1316),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE+AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTESAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRT+GTHP+SSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTVGTHPNSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABJ90272.2|  matrix protein 1 [Influenza A virus (A/ostrich/Italy/984/00(H7N1))]
 gb|ABJ90283.2|  matrix protein 1 [Influenza A virus (A/ostrich/Italy/984/00(H7N1))]
 gb|ABO45249.1|  matrix protein 1 [Influenza A virus (A/ostrich/Italy/1038/2000(H7N1))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYN+MGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNKMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABJ90262.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/5093/99(H7N1))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMD+AVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAW78063.1|  matrix protein [Influenza A virus (A/chicken/Korea/S6/03(H3N2))]
 gb|AAW78065.1|  matrix protein [Influenza A virus (A/duck/Korea/S8/03(H3N2))]
 gb|AAW78066.1|  matrix protein [Influenza A virus (A/duck/Korea/S9/03(H3N2))]
 gb|AAW78067.1|  matrix protein [Influenza A virus (A/duck/Korea/S10/03(H3N2))]
Length=255

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  4    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  63

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  64   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  123

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  124  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  183

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  184  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  243

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  244  QKRMGVQMQRFK  255


>gb|ACF08306.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/02311/2002(H9N2))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 246/252 (97%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEVSLSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVSLSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM  TTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVATTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAT12049.1|  matrix protein [Influenza A virus (A/duck/Guangdong/12/2000(H5N1))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMV AMRTIGTHPSSSAGLKD+LLEN QAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVQAMRTIGTHPSSSAGLKDNLLENSQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABI85012.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/1285/2000(H7N1))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VF GKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFVGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>sp|Q76V02.1|M1_I80AC  RecName: Full=Matrix protein 1; Short=M1
 sp|Q76V03.1|M1_I79A8  RecName: Full=Matrix protein 1; Short=M1
 sp|Q76V05.1|M1_I80A8  RecName: Full=Matrix protein 1; Short=M1
 943 more sequence titles
 sp|Q77W48.1|M1_I71A2  RecName: Full=Matrix protein 1; Short=M1
 sp|Q08IG8.1|M1_I80A6  RecName: Full=Matrix protein 1; Short=M1
 sp|Q0A457.1|M1_I66A1  RecName: Full=Matrix protein 1; Short=M1
 sp|Q20NV9.1|M1_I80AD  RecName: Full=Matrix protein 1; Short=M1
 sp|Q20P02.1|M1_I68A3  RecName: Full=Matrix protein 1; Short=M1
 sp|Q20PM1.1|M1_I79A7  RecName: Full=Matrix protein 1; Short=M1
 gb|AAD25173.1|AF073181_1  matrix protein 1 [influenza A virus (A/Chicken/New York/13142-5/94 
(H7N2NSB))]
 gb|AAD25205.1|AF073197_1  matrix protein 1 [influenza A virus (A/Turkey/Oregon/71 (H7N3NSB))]
 gb|AAD25207.1|AF073198_1  matrix protein 1 [influenza A virus (A/Turkey/Colorado/13356/91 
(H7N3NSA))]
 gb|AAD25209.1|AF073199_1  matrix protein 1 [influenza A virus (A/Rhea/North Carolina/39482/93 
(H7N1NSA))]
 gb|AAD25215.1|AF073202_1  matrix protein 1 [influenza A virus (A/Mallard/Wisconsin/169/75 
(H5N3NSA))]
 gb|AAD25219.1|AF073204_1  matrix protein 1 [influenza A virus (A/Emu/Texas/39924/93 (H5N2NSA))]
 gb|AAD49093.1|AF156470_2  matrix protein M1 [Influenza A virus (A/Quail/Arkansas/29209-1/93 
(H9N2))]
 gb|AAD49095.1|AF156471_2  matrix protein M1 [influenza A virus (A/Turkey/California/189/66(H9N2))]
 gb|AAG17430.1|AF285886_1  matrix protein [Influenza A virus (A/Swine/Ontario/01911-1/99 
(H4N6))]
 gb|AAQ04973.1|AF508684_1  matrix protein M1 [Influenza A virus (A/Ostrich/South Africa/9508103/95(H9N2))]
 gb|AAQ04976.1|AF508687_1  matrix protein M1 [Influenza A virus (A/Chicken/Germany/R45/98(H9N2))]
 gb|AAQ04980.1|AF508691_1  matrix protein M1 [Influenza A virus (A/Pheasant/Ireland/PV18/97(H9N2))]
 gb|AAB19773.1|  M1=membrane protein [influenza A virus, TYMN80, Peptide, 252 
aa]
 gb|AAA43262.1|  M1 matrix protein [Influenza A virus (A/duck/Bavaria/2/1977(H1N1))]
 gb|AAA43296.1|  membrane protein M1 [Influenza A virus (A/gull/Massachusetts/26/80(H13N6))]
 gb|AAA43300.1|  membrane protein M1 [Influenza A virus (A/gull/Maryland/1815/79 
(H13N6))]
 gb|AAA43349.1|  membrane protein M1 [Influenza A virus (A/turkey/Minnesota/833/80(H4N2))]
 emb|CAA81464.1|  Matrix Protein [Influenza A virus (A/Anas acuta/Primorje/695/79(H3N2))]
 emb|CAA81467.1|  Matrix Protein [Influenza A virus (A/oystercatcher/Germany/87(H1N1))]
 gb|AAB50986.1|  matrix protein M1 [Influenza A virus (A/swine/Hong Kong/168/1993(H1N1))]
 gb|AAB50988.1|  matrix protein M1 [Influenza A virus (A/duck/Nanchang/1749/1992(H11N2))]
 gb|AAB50992.1|  matrix protein M1 [Influenza A virus (A/chicken/Hong Kong/14/1976(H1N1))]
 emb|CAD20326.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Hong Kong/399/99(H3N8))]
 emb|CAD20332.1|  matrix protein 1 [Influenza A virus (A/curlew sandpiper/Hong 
Kong/208/89(H10N5))]
 gb|AAO92803.1|  matrix protein 1 [Influenza A virus (A/Chicken/New York/12273-11/99(H7N3))]
 gb|AAO92807.1|  matrix protein 1 [Influenza A virus (A/chicken/NY/14714-9/99(H7N3))]
 gb|AAO92833.1|  matrix protein 1 [Influenza A virus (A/Duck/NJ/117228-7/01(H7N3))]
 gb|AAO92835.1|  matrix protein 1 [Influenza A virus (A/Duck/PA/143585/01(H7N3))]
 gb|AAP49154.1|  matrix protein [Influenza A virus (A/Duck/Hong Kong/86/76(H9N2))]
 gb|AAP49156.1|  matrix protein [Influenza A virus (A/Duck/Shantou/1588/00(H9N1))]
 gb|AAP49157.1|  matrix protein [Influenza A virus (A/Duck/Shantou/2030/00(H9N1))]
 gb|AAP57567.1|  membrane protein [Influenza A virus (A/chukar/MN/14591-7/1998(H5N2))]
 gb|AAP57568.1|  membrane protein [Influenza A virus (A/pheasant/NJ/1355/98(H5N2))]
 gb|AAP57572.1|  membrane protein [Influenza A virus (A/avian/NY/31588-2/00(H5N2))]
 gb|AAP57573.1|  membrane protein [Influenza A virus (A/avian/NY/31588-3/00(H5N2))]
 gb|AAP57574.1|  membrane protein [Influenza A virus (A/duck/NY/44018-1/00(H5N2))]
 gb|AAP57575.1|  membrane protein [Influenza A virus (A/duck/NY/44018-2/00(H5N2))]
 gb|AAP57576.1|  membrane protein [Influenza A virus (A/chukkar/NY/51375/00(H5N2))]
 gb|AAP57577.1|  membrane protein [Influenza A virus (A/avian/NY/53726/00(H5N2))]
 gb|AAP57580.1|  membrane protein [Influenza A virus (A/duck/NJ/117228-7/01(H5N2))]
 gb|AAP57581.1|  membrane protein [Influenza A virus (A/unknown/NY/118547-11/01(H5N2))]
 gb|AAP57583.1|  membrane protein [Influenza A virus (A/duck/NY/185502/02(H5N2))]
 gb|AAP57584.1|  membrane protein [Influenza A virus (A/duck/NY/186875/02(H5N2))]
 gb|AAP57585.1|  membrane protein [Influenza A virus (A/duck/NY/191255-79/02(H5N2))]
 gb|AAP57589.1|  membrane protein [Influenza A virus (A/duck/NY/191255-59/02(H5N8))]
 gb|AAQ77432.1|  matrix protein 1 [Influenza A virus (A/chicken/Chile/176822/02(H7N3))]
 gb|AAQ77434.1|  matrix protein 1 [Influenza A virus (A/chicken/Chile/4322/02(H7N3))]
 gb|AAQ77436.1|  matrix protein 1 [Influenza A virus (A/chicken/Chile/4957/02(H7N3))]
 gb|AAQ77438.1|  matrix protein 1 [Influenza A virus (A/chicken/Chile/4968/02(H7N3))]
 gb|AAQ77440.1|  matrix protein 1 [Influenza A virus (A/chicken/Chile/4977/02(H7N3))]
 gb|AAQ77442.1|  matrix protein 1 [Influenza A virus (A/turkey/Chile/4418/02(H7N3))]
 gb|AAR11371.1|  matrix protein [Influenza A virus (A/Netherlands/219/03(H7N7))]
 gb|AAR11372.1|  matrix protein [Influenza A virus (A/Netherlands/33/03(H7N7))]
 gb|AAR11373.1|  matrix protein [Influenza A virus (A/chicken/Netherlands/1/03(H7N7))]
 emb|CAF02292.1|  membrane protein 1 [Influenza A virus (A/chicken/Germany/R28/03(H7N7))]
 emb|CAF33014.1|  membrane protein M1 [Influenza A virus (A/turkey/Italy/4603/1999(H7N1))]
 gb|AAT12051.1|  matrix protein [Influenza A virus (A/duck/Guangdong/40/2000(H5N1))]
 gb|AAT38820.1|  matrix protein 1 [Influenza A virus (A/chicken/British Columbia/04(H7N3))]
 gb|AAT65422.1|  matrix protein [Influenza A virus (A/mallard/Alberta/743/83(H9N1))]
 gb|AAT65423.1|  matrix protein [Influenza A virus (A/mallard/Alberta/111/99(H4N6))]
 gb|AAT65424.1|  matrix protein [Influenza A virus (A/mallard/Alberta/117/97(H3N8))]
 gb|AAT65425.1|  matrix protein [Influenza A virus (A/mallard/Alberta/119/00(H4N6))]
 gb|AAT65426.1|  matrix protein [Influenza A virus (A/mallard/Alberta/127/00(H3N8))]
 gb|AAT65427.1|  matrix protein [Influenza A virus (A/mallard/Alberta/136/00(H4N6))]
 gb|AAT65428.1|  matrix protein [Influenza A virus (A/mallard/Alberta/17/91(H9N2))]
 gb|AAT65430.1|  matrix protein [Influenza A virus (A/mallard/Alberta/202/96(H2N5))]
 gb|AAT65433.1|  matrix protein [Influenza A virus (A/Mallard/Alberta/206/96(H6N8))]
 gb|AAT65434.1|  matrix protein [Influenza A virus (A/mallard/Alberta/211/98(H1N1))]
 gb|AAT65435.1|  matrix protein [Influenza A virus (A/mallard/Alberta/215/99(H6N8))]
 gb|AAT65436.1|  matrix protein [Influenza A virus (A/mallard/Alberta/226/98(H2N3))]
 gb|AAT65438.1|  matrix protein [Influenza A virus (A/mallard/Alberta/242/98(H3N8))]
 gb|AAT65439.1|  matrix protein [Influenza A virus (A/mallard/Alberta/279/98(H3N8))]
 gb|AAT65440.1|  matrix protein [Influenza A virus (A/mallard/Alberta/295/98(H4N6))]
 gb|AAT65441.1|  matrix protein [Influenza A virus (A/mallard/Alberta/30/98 (H4N6))]
 gb|AAT65442.1|  matrix protein [Influenza A virus (A/mallard/Alberta/321/88(H9N2))]
 gb|AAT65443.1|  matrix protein [Influenza A virus (A/mallard/Alberta/47/98(H4N1))]
 gb|AAT65444.1|  matrix protein [Influenza A virus (A/mallard/Alberta/11/91(H9N2))]
 gb|AAT65450.1|  matrix protein [Influenza A virus (A/pintail/Alberta/156/97(H3N8))]
 gb|AAT65451.1|  matrix protein [Influenza A virus (A/pintail/Alberta/207/99(H4N8))]
 gb|AAT65454.1|  matrix protein [Influenza A virus (A/pintail/Alberta/37/99(H3N8))]
 gb|AAT69349.1|  matrix protein 1 [Influenza A virus (A/GSC_chicken/British Columbia/04(H7N3))]
 gb|AAT70171.1|  matrix protein 1 [Influenza A virus (A/GSC_chicken_B/British 
Columbia/04(H7N3))]
 gb|AAT70609.1|  matrix protein 1 [Influenza A virus (A/Dk/ST/5048/2001(H3N8))]
 gb|AAT70611.1|  matrix protein 1 [Influenza A virus (A/WDk/ST/1737/2000(H6N8))]
 gb|AAT70615.1|  matrix protein 1 [Influenza A virus (A/wild duck/Shantou/1411/2000(H11N3))]
 gb|AAT78583.1|  matrix protein 1 [Influenza A virus (A/chicken/British Columbia/GSC_human_B/04(H7N3))]
 gb|AAU25858.1|  matrix protein 1 [Influenza A virus (A/swine/Ontario/K01477/01(H3N3))]
 gb|AAU25869.1|  matrix protein 1 [Influenza A virus (A/swine/Ontario/42729A/01(H3N3))]
 emb|CAF21873.1|  matrix protein [Influenza A virus (A/duck/Primorie/2633/01(H5N3))]
 gb|AAY87412.1|  matrix protein 1 [Influenza A virus (A/mallard/Postdam/178-4/83(H2N2))]
 gb|AAY87420.1|  matrix protein 1 [Influenza A virus (A/mallard/Postdam/178-4/83(H2N2))]
 gb|AAY87430.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/24/01(H7N3))]
 gb|AAY87446.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/24/01(H7N3))]
 gb|AAY96426.1|  matrix protein [Influenza A virus (A/blue-winged teal/LA/3B/88(H4N8))]
 gb|AAY96427.1|  matrix protein [Influenza A virus (A/blue-winged teal/LA/B182/88(H4N6))]
 gb|AAY96428.1|  matrix protein [Influenza A virus (A/blue-winged teal/TX/11/01(H7N4))]
 gb|AAY96429.1|  matrix protein [Influenza A virus (A/green-winged teal/TX/7/01(H8N4))]
 gb|AAY96430.1|  matrix protein [Influenza A virus (A/laughing gull/NY/2455/00(H7N3))]
 gb|AAY96431.1|  matrix protein [Influenza A virus (A/laughing gull/NY/470/00(H6N4))]
 gb|AAY96433.1|  matrix protein [Influenza A virus (A/mallard/MN/133/98(H5N2))]
 gb|AAY96434.1|  matrix protein [Influenza A virus (A/mallard/MN/145/99(H4N6))]
 gb|AAY96436.1|  matrix protein [Influenza A virus (A/mallard/MN/154/99(H4N8))]
 gb|AAY96439.1|  matrix protein [Influenza A virus (A/mallard/MN/175/99(H6N8))]
 gb|AAY96441.1|  matrix protein [Influenza A virus (A/mallard/MN/186/99(H9N2))]
 gb|AAY96442.1|  matrix protein [Influenza A virus (A/mallard/MN/187/98(H7N3))]
 gb|AAY96443.1|  matrix protein [Influenza A virus (A/mallard/MN/190/98(H7N3))]
 gb|AAY96444.1|  matrix protein [Influenza A virus (A/mallard/MN/192/99(H4N6))]
 gb|AAY96445.1|  matrix protein [Influenza A virus (A/mallard/MN/195/99(H4N6))]
 gb|AAY96446.1|  matrix protein [Influenza A virus (A/mallard/MN/198/99(H4N6))]
 gb|AAY96447.1|  matrix protein [Influenza A virus (A/mallard/MN/2/98(H4N6))]
 gb|AAY96449.1|  matrix protein [Influenza A virus (A/mallard/MN/218/99(H3N8))]
 gb|AAY96450.1|  matrix protein [Influenza A virus (A/mallard/MN/225/99(H3N8))]
 gb|AAY96451.1|  matrix protein [Influenza A virus (A/mallard/MN/231/99(H3N8))]
 gb|AAY96454.1|  matrix protein [Influenza A virus (A/mallard/MN/263/99(H4N9))]
 gb|AAY96457.1|  matrix protein [Influenza A virus (A/mallard/MN/283/99(H3N8))]
 gb|AAY96460.1|  matrix protein [Influenza A virus (A/mallard/MN/31/98(H6N8))]
 gb|AAY96462.1|  matrix protein [Influenza A virus (A/mallard/MN/351/99(H3N4))]
 gb|AAY96463.1|  matrix protein [Influenza A virus (A/mallard/MN/354/99(H3N8))]
 gb|AAY96464.1|  matrix protein [Influenza A virus (A/mallard/MN/365/99(H9N2))]
 gb|AAY96465.1|  matrix protein [Influenza A virus (A/mallard/MN/403/99(H11N9))]
 gb|AAY96467.1|  matrix protein [Influenza A virus (A/mallard/MN/68/99(H3N2))]
 gb|AAY96468.1|  matrix protein [Influenza A virus (A/mallard/MN/7/98(H11N2))]
 gb|AAY96469.1|  matrix protein [Influenza A virus (A/mallard/MN/88/98(H7N3))]
 gb|AAY96470.1|  matrix protein [Influenza A virus (A/mottled duck/LA/32M/87(H6N2))]
 gb|AAY96471.1|  matrix protein [Influenza A virus (A/mottled duck/LA/38M/87(H6N2))]
 gb|AAY96472.1|  matrix protein [Influenza A virus (A/pintail/MN/410/99(H6N8))]
 gb|AAY96473.1|  matrix protein [Influenza A virus (A/pintail/MN/423/99(H7N3))]
 gb|AAY96474.1|  matrix protein [Influenza A virus (A/pintail/MN/431/99(H6N2))]
 gb|AAY96475.1|  matrix protein [Influenza A virus (A/pintail/MN/479/99(H3N6))]
 gb|AAY96476.1|  matrix protein [Influenza A virus (A/ruddy turnstone/DE/1538/00(H7N9))]
 gb|AAY96477.1|  matrix protein [Influenza A virus (A/ruddy turnstone/DE/1794/00(H12N4))]
 gb|AAY96478.1|  matrix protein [Influenza A virus (A/ruddy turnstone/DE/629/00(H7N9))]
 gb|AAY96480.1|  matrix protein [Influenza A virus (A/ruddy turnstone/NJ/892/02(H6N4))]
 gb|AAY96481.1|  matrix protein [Influenza A virus (A/semi-palmated sandpiper/DE/2109/00(H11N6))]
 gb|AAY96482.1|  matrix protein [Influenza A virus (A/wild bird/DE/1185/02(H6N8))]
 gb|AAY96488.1|  matrix protein [Influenza A virus (A/northern pintail/TX/828189/02(H6))]
 gb|AAY96489.1|  matrix protein [Influenza A virus (A/sanderling/DE/650680/02(H6))]
 gb|AAY96490.1|  matrix protein [Influenza A virus (A/ruddy turnstone/DE/241731/01(H6))]
 gb|AAY96491.1|  matrix protein [Influenza A virus (A/ring-bill gull/DE/421733/01(H6))]
 gb|AAY96492.1|  matrix protein [Influenza A virus (A/mallard/MN/346233/00(H6N3))]
 gb|AAY96494.1|  matrix protein [Influenza A virus (A/ruddy turnstone/DE/650679/02(H6))]
 gb|AAY96495.1|  matrix protein [Influenza A virus (A/blue-winged teal/LA/166B/88(H4N6))]
 gb|AAY96498.1|  matrix protein [Influenza A virus (A/mallard/OH/115/89(H6N8))]
 gb|AAY96500.1|  matrix protein [Influenza A virus (A/wood duck/MD/M58/98(H9N8))]
 gb|AAY96502.1|  matrix protein [Influenza A virus (A/mallard/MD/R326/98(H6N4))]
 gb|AAY96503.1|  matrix protein [Influenza A virus (A/mallard/MD/R274/98(H6N5))]
 gb|AAY96505.1|  matrix protein [Influenza A virus (A/mallard/OH/249/98(H6))]
 gb|AAY96506.1|  matrix protein [Influenza A virus (A/pintail/OH/25/99(H6))]
 gb|AAY96507.1|  matrix protein [Influenza A virus (A/mallard/OH/66/99(H6N1))]
 gb|AAY96508.1|  matrix protein [Influenza A virus (A/green-winged teal/OH/72/99(H6))]
 gb|AAY96510.1|  matrix protein [Influenza A virus (A/blue-winged teal/OH/240B/88(H4N6))]
 gb|AAY96512.1|  matrix protein [Influenza A virus (A/mallard/MN/371/98(H4N2))]
 gb|AAY96513.1|  matrix protein [Influenza A virus (A/mallard/MN/33/00(H4))]
 gb|AAY96514.1|  matrix protein [Influenza A virus (A/mallard/MN/348/00(H4N6))]
 gb|AAY96515.1|  matrix protein [Influenza A virus (A/ruddy turnstone/NJ/1407/01(H4N6))]
 gb|AAY96516.1|  matrix protein [Influenza A virus (A/guinea fowl/NJ/14190-23/96(H4N8))]
 gb|AAY96517.1|  matrix protein [Influenza A virus (A/mallard/OH/338/86(H4N8))]
 gb|AAY96518.1|  matrix protein [Influenza A virus (A/blue-winged teal/LA/B156/88(H4N6))]
 gb|AAY96519.1|  matrix protein [Influenza A virus (A/blue-winged teal/LA/69B/87(H4N6))]
 gb|AAY96520.1|  matrix protein [Influenza A virus (A/mallard/MN/347/99(H4N8))]
 gb|AAY96521.1|  matrix protein [Influenza A virus (A/mallard/MN/352/99(H4N8))]
 gb|AAY96522.1|  matrix protein [Influenza A virus (A/green-winged teal/AK/5937/01(H4N8))]
 gb|ABB17151.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/77/1977(H2N3))]
 gb|ABB17693.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/884/1984(H2N5))]
 gb|ABB17704.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/376/1985(H2N3))]
 gb|ABB17715.1|  matrix protein 1 [Influenza A virus (A/sanderling/NJ/766/1986(H2N7))]
 gb|ABB17726.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/703/1988(H2N8))]
 gb|ABB17737.1|  matrix protein 1 [Influenza A virus (A/laughing gull/NJ/798/1986(H2N7))]
 gb|ABB17747.1|  matrix protein 1 [Influenza A virus (A/mallard duck/Alberta/323/1988(H2N1))]
 gb|ABB17757.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/353/1988(H2N3))]
 gb|ABB17814.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/201/1996(H2N3))]
 gb|ABB18026.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/202/1996(H2N5))]
 gb|ABB18037.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/16/1997(H2N9))]
 gb|ABB18048.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/205/1998(H2N3))]
 gb|ABB18059.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/226/1998(H2N3))]
 gb|ABB18070.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/149/2002(H2N4))]
 gb|ABB18081.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/79/2003(H2N3))]
 gb|ABB18132.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/670/1988(H2N9))]
 gb|ABB18379.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/698/1988(H2N1))]
 gb|ABB18477.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/48/1978(H6N5))]
 gb|ABB18995.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/761/1978(H6N8))]
 gb|ABB19047.1|  matrix protein 1 [Influenza A virus (A/knot/DE/526/1988(H6N8))]
 gb|ABB19056.1|  matrix protein 1 [Influenza A virus (A/laughing gull/NJ/276/1989(H6N8))]
 gb|ABB19102.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/730/1981(H6N1))]
 gb|ABB19185.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/76/1985(H6N3))]
 gb|ABB19361.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/199/1992(H6N5))]
 gb|ABB19372.1|  matrix protein 1 [Influenza A virus (A/pintail/ALB/179/1993(H6N1))]
 gb|ABB19383.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/206/1996(H6N8))]
 gb|ABB19394.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/154/2003(H6N5))]
 gb|ABB19405.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/12/2004(H6N8))]
 gb|ABB19415.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/65/1976(H1N1))]
 gb|ABB19422.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/130/2003(H1N1))]
 gb|ABB19430.1|  matrix protein 1 [Influenza A virus (A/pintail/Alberta/166/2003(H3N6))]
 gb|ABB19437.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/20/1976(H4N6))]
 gb|ABB19445.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/254/2003(H4N6))]
 gb|ABB19463.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/60/1976(H12N5))]
 gb|ABB19477.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/49/1985(H4N9))]
 gb|ABB19482.1|  matrix protein 1 [Influenza A virus (A/laughing gull/DE/5/2003(H9N1))]
 gb|ABB19492.1|  matrix protein 1 [Influenza A virus (A/red knot/Delaware/2561/87(H10N5))]
 gb|ABB19508.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/42/1977(H1N6))]
 gb|ABB19519.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/46/1977(H1N1))]
 gb|ABB19530.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/219/1977(H1N1))]
 gb|ABB19541.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/238/1979(H1N1))]
 gb|ABB19552.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/965/1979(H1N1))]
 gb|ABB19563.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/631/1981(H1N5))]
 gb|ABB19575.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/201/1998(H1N1))]
 gb|ABB19608.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/322/1988(H1N1))]
 gb|ABB19640.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/692/1988(H2N8))]
 gb|ABB19650.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/25/1976(H3N1))]
 gb|ABB19654.1|  matrix protein 1 [Influenza A virus (A/canvasback duck/ALB/102/1976(H3N6))]
 gb|ABB19661.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/286/1977(H3N6))]
 gb|ABB19668.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/127/1977(H1N1))]
 gb|ABB19678.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/663/1979(H3N5))]
 gb|ABB19686.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/1012/1979(H3N4))]
 gb|ABB19694.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/506/1983(H9N1))]
 gb|ABB19705.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/438/1985(H3N4))]
 gb|ABB19713.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/525/1985(H3N8))]
 gb|ABB19724.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/569/1985(H3N8))]
 gb|ABB19737.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/129/1991(H3N6))]
 gb|ABB19745.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/118/1995(H3N5))]
 gb|ABB19755.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/31/2001(H3N9))]
 gb|ABB19759.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/156/2001(H3N8))]
 gb|ABB19775.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/159/1977(H4N6))]
 gb|ABB19785.1|  matrix protein 1 [Influenza A virus (A/laughing gull/NJ/72/1985(H4N9))]
 gb|ABB19794.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/25/1985(H4N6))]
 gb|ABB19803.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/562/1985(H4N6))]
 gb|ABB19812.1|  matrix protein 1 [Influenza A virus (A/knot/DE/541/1988(H4N6))]
 gb|ABB19822.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/665/1988(H4N6))]
 gb|ABB19831.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/2368/1988(H4N9))]
 gb|ABB19840.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/67/1990(H4N5))]
 gb|ABB19848.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/49/1995(H4N6))]
 gb|ABB19858.1|  matrix protein 1 [Influenza A virus (A/pintail/ALB/275/1996(H4N6))]
 gb|ABB19868.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/47/1998(H4N1))]
 gb|ABB19879.1|  matrix protein 1 [Influenza A virus (A/pintail/Alberta/207/1999(H4N8))]
 gb|ABB19897.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/645/1980(H5N2))]
 gb|ABB19909.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/39/1982(H8N4))]
 gb|ABB19912.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/7/1987(H8N4))]
 gb|ABB19920.1|  matrix protein 1 [Influenza A virus (A/gadwall duck/ALB/291/1977(H7N3))]
 gb|ABB19929.1|  matrix protein 1 [Influenza A virus (A/pintail duck/Alberta/121/1979(H7N8))]
 gb|ABB19936.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/435/1985(H7N3))]
 gb|ABB19958.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/66/2003(H9N2))]
 gb|ABB19982.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/742/1981(H10N1))]
 gb|ABB19989.1|  matrix protein 1 [Influenza A virus (A/redhead duck/ALB/767/1984(H10N7))]
 gb|ABB19996.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/2764/1987(H10N7))]
 gb|ABB20011.1|  matrix protein 1 [Influenza A virus (A/redhead duck/Alberta/357/1983(H11N9))]
 gb|ABB20025.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware/2589/1987(H11N1))]
 gb|ABB20041.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/637/1988(H11N9))]
 gb|ABB20050.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/842/1989(H11N1))]
 gb|ABB20060.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/126/1991(H11N9))]
 gb|ABB20069.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/125/1999(H11N6))]
 gb|ABB20078.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/306/1983(H12N5))]
 gb|ABB20086.1|  matrix protein 1 [Influenza A virus (A/laughing gull/DE/94/2000(H12N4))]
 gb|ABB20111.1|  matrix protein 1 [Influenza A virus (A/laughing gull/DE/554/1988(H13N3))]
 gb|ABB20129.1|  matrix protein 1 [Influenza A virus (A/mallard duck/AST/244/1982(H14N6))]
 gb|ABB20152.1|  matrix protein 1 [Influenza A virus (A/sanderling/DE/1258/1986(H6N6))]
 gb|ABB20209.1|  matrix protein 1 [Influenza A virus (A/duck/Nanchang/1904/1992(H7N1))]
 gb|ABB20219.1|  matrix protein 1 [Influenza A virus (A/duck/Nanchang/1749/1992(H11N2))]
 gb|ABB20241.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/278/1978(H2N9))]
 gb|ABB20250.1|  matrix protein 1 [Influenza A virus (A/goose/HK/10/1976(H3N2))]
 gb|ABB20255.1|  matrix protein 1 [Influenza A virus (A/duck/HK/231/1977(H3N6))]
 gb|ABB20284.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/d73/1976(H6N1))]
 gb|ABB20295.1|  matrix protein 1 [Influenza A virus (A/chicken/Hong Kong/17/1977(H6N1))]
 gb|ABB20305.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/d134/1977(H6N2))]
 gb|ABB20315.1|  matrix protein 1 [Influenza A virus (A/duck/HK/784/1979(H9N2))]
 gb|ABB20325.1|  matrix protein 1 [Influenza A virus (A/duck/HK/147/1977(H9N6))]
 gb|ABB20335.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/562/1979(H10N9))]
 gb|ABB20344.1|  matrix protein 1 [Influenza A virus (A/shearwater/Australia/405/1978(H3N8))]
 gb|ABB20353.1|  matrix protein 1 [Influenza A virus (A/gray teal/Australia/1/1979(H6N1))]
 gb|ABB20363.1|  matrix protein 1 [Influenza A virus (A/gray teal/Australia/2/1979(H4N4))]
 gb|ABB20373.1|  matrix protein 1 [Influenza A virus (A/gray teal/AUS/3/1979(H4N6))]
 gb|ABB20424.1|  matrix protein 1 [Influenza A virus (A/duck/NZL/31/1976(H4N6))]
 gb|ABB20435.1|  matrix protein 1 [Influenza A virus (A/duck/New Zealand/164/76(H11N3))]
 gb|ABB20452.1|  matrix protein 1 [Influenza A virus (A/duck/NZL/78/1984(H9N2))]
 gb|ABB20467.1|  matrix protein 1 [Influenza A virus (A/mallard/Potsdam/177-4/1983(H2N2))]
 gb|ABB20473.1|  matrix protein 1 [Influenza A virus (A/duck/Potsdam/1402-6/1986(H5N2))]
 gb|ABB20483.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3620/1999(H7N1))]
 gb|ABB20525.1|  matrix protein 1 [Influenza A virus (A/turkey/Ontario/6118/1968(H8N4))]
 gb|ABB21742.1|  matrix protein 1 [Influenza A virus (A/mallard/Netherlands/12/2000(H7N3))]
 gb|ABB21752.1|  matrix protein 1 [Influenza A virus (A/shoveler/Netherlands/19/1999(H11N9))]
 gb|ABB21762.1|  matrix protein 1 [Influenza A virus (A/gull/Minnesota/945/1980(H13N6))]
 gb|ABB21773.1|  matrix protein 1 [Influenza A virus (A/pigeon/MN/1407/1981(H1N1))]
 gb|ABB21804.1|  matrix protein 1 [Influenza A virus (A/duck/Minnesota/1516/1981(H5N2))]
 gb|ABB21820.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/833/1980(H4N2))]
 gb|ABB80527.1|  matrix [Influenza A virus (A/blue-winged teal/Barbados/21/04(H4N3))]
 gb|ABB83594.1|  matrix protein 1 [Influenza A virus (A/mallard/Denmark/64650/03(H5N7))]
 gb|ABB86512.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/475/1986(H13N2))]
 gb|ABB86786.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/564/1979(H3N8))]
 gb|ABB86797.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/676/1979(H3N6))]
 gb|ABB87035.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/31/1976(H3N8))]
 gb|ABB87043.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/57/1976(H5N2))]
 gb|ABB87164.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/396/1983(H9N1))]
 gb|ABB87207.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/303/1977(H10N7))]
 gb|ABB87218.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/209/2003(H10N7))]
 gb|ABB87229.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/294/1977(H11N9))]
 gb|ABB87240.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/245/2003(H11N9))]
 gb|ABB87250.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/52/1997(H12N5))]
 gb|ABB87282.1|  matrix protein 1 [Influenza A virus (A/herring gull/NJ/402/1989(H5N3))]
 gb|ABB87293.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/101/2004(H5N7))]
 gb|ABB87304.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/65/1985(H7N3))]
 gb|ABB87315.1|  matrix protein 1 [Influenza A virus (A/knot/DE/2552/1987(H9N5))]
 gb|ABB87326.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/10/2004(H10N7))]
 gb|ABB87346.1|  matrix protein 1 [Influenza A virus (A/herring gull/NJ/782/1986(H13N2))]
 gb|ABB87357.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/712/1988(H16N3))]
 gb|ABB87367.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/773/1988(H9N6))]
 gb|ABB87389.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/712/1978(H3N3))]
 gb|ABB87400.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/ALB/438/1979(H3N8))]
 gb|ABB87411.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/462/1979(H3N6))]
 gb|ABB87430.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/452/1983(H3N1))]
 gb|ABB87441.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/635/1983(H3N5))]
 gb|ABB87452.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/394/1988(H3N3))]
 gb|ABB87463.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/26/1976(H3N1))]
 gb|ABB87474.1|  matrix protein 1 [Influenza A virus (A/canvasback duck/ALB/274/1977(H4N6))]
 gb|ABB87485.1|  matrix protein 1 [Influenza A virus (A/gadwall duck/ALB/53/1977(H4N6))]
 gb|ABB87496.1|  matrix protein 1 [Influenza A virus (A/redhead duck/ALB/74/1977(H4N6))]
 gb|ABB87507.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/243/1977(H4N6))]
 gb|ABB87518.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/210/1977(H4N8))]
 gb|ABB87529.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/161/1977(H4N6))]
 gb|ABB87551.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/354/1978(H4N2))]
 gb|ABB87562.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/106/1979(H4N2))]
 gb|ABB87573.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/580/1979(H4N2))]
 gb|ABB87584.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/599/1979(H4N2))]
 gb|ABB87595.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/581/1983(H4N4))]
 gb|ABB87605.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/47/1985(H4N6))]
 gb|ABB87616.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/630/1984(H4N2))]
 gb|ABB87627.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/623/1985(H4N6))]
 gb|ABB87638.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/512/1988(H4N6))]
 gb|ABB87657.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/136/1990(H4N3))]
 gb|ABB87668.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/293/1994(H4N6))]
 gb|ABB87679.1|  matrix protein 1 [Influenza A virus (A/pintail/Alberta/269/2001(H4N6))]
 gb|ABB87690.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Alberta/293/2003(H4N6))]
 gb|ABB87701.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/291/1977(H4N1))]
 gb|ABB87712.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/75/2004(H5N7))]
 gb|ABB87723.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/283/1977(H8N4))]
 gb|ABB87741.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/194/1992(H8N4))]
 gb|ABB87752.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/224/1977(H7N5))]
 gb|ABB87763.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/295/1977(H7N3))]
 gb|ABB87774.1|  matrix protein 1 [Influenza A virus (A/widgeon/Alberta/284/1977(H7N3))]
 gb|ABB87790.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/169/1980(H3N8))]
 gb|ABB87801.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/ALB/228/1985(H7N3))]
 gb|ABB87812.1|  matrix protein 1 [Influenza A virus (A/laughing gull/DE/2838/1987(H13N2))]
 gb|ABB87823.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/2378/1988(H7N7))]
 gb|ABB87834.1|  matrix protein 1 [Influenza A virus (A/red knot/NJ/325/1989(H7N7))]
 gb|ABB87845.1|  matrix protein 1 [Influenza A virus (A/pintail/Alberta/129/1993(H10N7))]
 gb|ABB87855.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/34/2001(H7N1))]
 gb|ABB87865.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/743/1983(H9N1))]
 gb|ABB87876.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/2576/1987(H9N5))]
 gb|ABB87887.1|  matrix protein 1 [Influenza A virus (A/laughing gull/DE/2718/1987(H9N5))]
 gb|ABB87897.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/2731/1987(H9N1))]
 gb|ABB87908.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/510/1988(H9N6))]
 gb|ABB87919.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/321/1988(H9N2))]
 gb|ABB87930.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/11/1991(H9N2))]
 gb|ABB87940.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/17/1991(H9N2))]
 gb|ABB87957.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/302/1977(H10N7))]
 gb|ABB87968.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/ALB/778/1978(H10N3))]
 gb|ABB87979.1|  matrix protein 1 [Influenza A virus (A/mallard duck/ALB/40/1984(H10N6))]
 gb|ABB87990.1|  matrix protein 1 [Influenza A virus (A/pintail duck/ALB/584/1984(H10N6))]
 gb|ABB88001.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/5/1995(H10N1))]
 gb|ABB88012.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/196/1996(H10N7))]
 gb|ABB88034.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/208/2000(H10N7))]
 gb|ABB88045.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/122/2004(H10N7))]
 gb|ABB88067.1|  matrix protein 1 [Influenza A virus (A/mallard/ALB/124/1991(H11N2))]
 gb|ABB88089.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/236/2003(H11N9))]
 gb|ABB88100.1|  matrix protein 1 [Influenza A virus (A/mallard duck/Alberta/342/1983(H12N1))]
 gb|ABB88111.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/ALB/199/1991(H12N5))]
 gb|ABB88122.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/97/2000(H12N5))]
 gb|ABB88139.1|  matrix protein 1 [Influenza A virus (A/wedge-tailed shearwater/Western 
Australia/2576/1979(H15N9))]
 gb|ABB88195.1|  matrix protein 1 [Influenza A virus (A/Duck/Nanchang/4-165/2000(H4N6))]
 gb|ABB88257.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/7/1975(H3N2))]
 gb|ABB88268.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/365/1978(H4N6))]
 gb|ABB88279.1|  matrix protein 1 [Influenza A virus (A/goose/Hong Kong/23/1978(H5N3))]
 gb|ABB88310.1|  matrix protein 1 [Influenza A virus (A/black duck/AUS/751/1978(H3N8))]
 gb|ABB88321.1|  matrix protein 1 [Influenza A virus (A/sooty tern/Western Australia/2190/1983(H15N9))]
 gb|ABB88332.1|  matrix protein 1 [Influenza A virus (A/wedge-tailed shearwater/Western 
Australia/2327/1983(H15N9))]
 gb|ABB88343.1|  matrix protein 1 [Influenza A virus (A/duck/NZL/38/1984(H3N8))]
 gb|ABB88349.1|  matrix protein 1 [Influenza A virus (A/duck/Potsdam/2216-4/1984(H5N6))]
 gb|ABB88360.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4169/1999(H7N1))]
 gb|ABB88391.1|  matrix protein 1 [Influenza A virus (A/goose/MN/5733-1/1980(H9N2))]
 gb|ABB90166.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/300/1977(H4N3))]
 gb|ABB90175.1|  matrix protein 1 [Influenza A virus (A/redhead duck/ALB/116/1985(H4N6))]
 dbj|BAE53688.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/Vac-2/04(H7N7))]
 gb|ABD35615.1|  matrix protein 1 [Influenza A virus (A/duck/Taiwan/A68/03(H6N1))]
 gb|ABD35625.1|  matrix protein 1 [Influenza A virus (A/duck/Taiwan/WB459/04(H6N5))]
 gb|ABF06630.1|  matrix protein 1 [Influenza A Virus (A/chicken/NSW/1/1997(H7N4))]
 gb|ABF22651.1|  matrix protein 1 [Influenza A virus (A/spotbill duck/Yangcheng/19/2005)]
 gb|ABF22661.1|  matrix protein 1 [Influenza A virus (A/mallard/Xuyi/8/2004(H11N?))]
 gb|ABF22667.1|  matrix protein 1 [Influenza A virus (A/baikal teal/Xuyi/18/2005)]
 gb|ABF22669.1|  matrix protein 1 [Influenza A virus (A/goosander/Hongze/7/2005)]
 dbj|BAE94703.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/Vac-1/04(H5N1))]
 dbj|BAE96037.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/9/99(H9N2))]
 dbj|BAE96571.1|  matrix protein 1 [Influenza A virus (A/R(duck/Mongolia/54/01-duck/Mongolia/47/01)(H5N1))]
 gb|ABG88213.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/430/1987(H1N1))]
 gb|ABG88224.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/298/1987(H4N6))]
 gb|ABG88235.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/97/1989(H4N2))]
 gb|ABG88246.1|  matrix protein 1 [Influenza A virus (A/wigeon/Ohio/379/1988(H5N2))]
 gb|ABG88257.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/56/1999(H1N1))]
 gb|ABH03500.1|  MA [Influenza A virus (A/Bewick's swan/Netherlands/2/2005(H6N8))]
 gb|ABI17569.1|  matrix protein 1 [Influenza A virus (A/duck/Primorie/3672/02(H4N2))]
 gb|ABI20816.1|  matrix protein 1 [Influenza A virus (A/pintail/Alaska/53/2005(H3N6))]
 gb|ABI30357.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/178/1999(H6N2))]
 gb|ABI33781.1|  matrix protein 1 [Influenza A virus (A/slaty-backed gull/Shandong/38/04(H5N1))]
 gb|ABI47996.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/657/2002(H4N6))]
 gb|ABI48007.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/908/2002(H3N2))]
 gb|ABI48018.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/275/1987(H4N2))]
 gb|ABI84389.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/27/2001(H7N3))]
 gb|ABI84391.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/267/1996(H1N1))]
 gb|ABI84401.1|  matrix protein 1 [Influenza A virus (A/mallard duck/Alberta/331/1985(H3N6))]
 gb|ABI84413.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Alberta/120/1991(H3N8))]
 gb|ABI84438.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware/76/2000(H10N4))]
 gb|ABI84448.1|  matrix protein 1 [Influenza A virus (A/shorebird/New Jersey/840/1986(H16N3))]
 gb|ABI84454.1|  matrix protein 1 [Influenza A virus (A/mallard duck/Astrakhan/263/1982(H14N5))]
 gb|ABI84479.1|  matrix protein 1 [Influenza A virus (A/duck/Australia/749/1980(H1N1))]
 gb|ABI84501.1|  matrix protein 1 [Influenza A virus (A/gull/Maryland/19/1977(H2N9))]
 gb|ABI84524.1|  matrix protein 1 [Influenza A virus (A/turkey/Wisconsin/1/1966(H9N2))]
 gb|ABI84557.1|  matrix protein 1 [Influenza A virus (A/duck/Memphis/546/1974(H11N9))]
 gb|ABI84578.1|  matrix protein 1 [Influenza A virus (A/duck/Chabarovsk/1610/1972 
(H3N8))]
 gb|ABI84609.1|  matrix protein 1 [Influenza A virus (A/duck/Minnesota/1525/1981(H5N1))]
 gb|ABI84618.1|  matrix protein 1 [Influenza A virus (A/duck/Minnesota/1375/1981(H1N1))]
 gb|ABI84638.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/5/1979(H10N8))]
 gb|ABI84650.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/836/1980(H6N2))]
 gb|ABI84658.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/1598/1981(H5N2))]
 gb|ABI84684.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/1200/1980(H7N3))]
 gb|ABI84695.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/1/1988(H7N9))]
 gb|ABI84714.1|  matrix protein 1 [Influenza A virus (A/turkey/Minnesota/1012/1990(H13N2))]
 gb|ABI84734.1|  matrix protein 1 [Influenza A virus (A/mallard duck/Tennessee/11464/1985(H1N1))]
 gb|ABI84776.1|  matrix protein 1 [Influenza A virus (A/mallard/New York/6874/1978(H3N2))]
 gb|ABI84785.1|  matrix protein 1 [Influenza A virus (A/mallard/New York/189/1982(H5N2))]
 gb|ABI84796.1|  matrix protein 1 [Influenza A virus (A/mallard duck/New York/180/1986(H4N9))]
 gb|ABI84807.1|  matrix protein 1 [Influenza A virus (A/mallard duck/New York/157/1986(H3N6))]
 gb|ABI84817.1|  matrix protein 1 [Influenza A virus (A/black duck/New York/184/1988(H5N2))]
 gb|ABI84828.1|  matrix protein 1 [Influenza A virus (A/chicken/New York/14677-13/1998(H6N2))]
 gb|ABI84856.1|  matrix protein 1 [Influenza A virus (A/mallard duck/New York/170/1982(H1N2))]
 gb|ABI84895.1|  matrix protein 1 [Influenza A virus (A/mallard duck/New York/194/1982(H4N8))]
 gb|ABI84906.1|  matrix protein 1 [Influenza A virus (A/pintail duck/New York/155/1982(H4N3))]
 gb|ABI84939.1|  matrix protein 1 [Influenza A virus (A/mallard duck/New York/174/1982(H3N8))]
 gb|ABI84949.1|  matrix protein 1 [Influenza A virus (A/mallard duck/New York/6861/1978(H1N5))]
 gb|ABI84990.1|  matrix protein 1 [Influenza A virus (A/environment/Canada/av41/2004(H7N3))]
 gb|ABI85001.1|  matrix protein 1 [Influenza A virus (A/Canada/rv504/2004(H7N3))]
 gb|ABI85019.1|  matrix protein 1 [Influenza A virus (A/chicken/Victoria/1985(H7N7))]
 gb|ABI85030.1|  matrix protein 1 [Influenza A virus (A/chicken/Chile/184240-4322/2002(H7N3))]
 gb|ABI85048.1|  matrix protein 1 [Influenza A virus (A/goose/Leipzig/187-7/1979(H7N7))]
 gb|ABI85075.1|  matrix protein 1 [Influenza A virus (A/starling/Victoria/5156/1985(H7N7))]
 gb|ABI85156.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/312/1997(H5N2))]
 gb|ABI85163.1|  matrix protein 1 [Influenza A virus (A/turkey/England/50-92/1991(H5N1))]
 gb|ABI85173.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware/105/1998(H6N8))]
 gb|ABI85184.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware/34/1993(H2N1))]
 gb|ABI85194.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware/81/1993(H2N1))]
 gb|ABI85201.1|  matrix protein 1 [Influenza A virus (A/shorebird/Delaware/224/1997(H13N6))]
 gb|ABI85209.1|  matrix protein 1 [Influenza A virus (A/arctic tern/Alaska/300/1975(H5N3))]
 gb|ABI85215.1|  matrix protein 1 [Influenza A virus (A/sabines gull/Alaska/296/1975(H5N3))]
 gb|ABI85222.1|  matrix protein 1 [Influenza A virus (A/black-legged kittywake/Alaska/295/1975(H16N3))]
 gb|ABI85226.1|  matrix protein 1 [Influenza A virus (A/murre/Alaska/305/1976(H1N6))]
 gb|ABI85234.1|  matrix protein 1 [Influenza A virus (A/duck/Alaska/658/1991(H10N2))]
 gb|ABI92182.1|  matrix protein 1 [Influenza A virus (A/black duck/Ohio/95/1993(H1N1))]
 gb|ABI92204.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/344/1986(H4N2))]
 gb|ABI92215.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/83/1986(H4N6))]
 gb|ABI92226.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/338/1986(H4N8))]
 gb|ABI92237.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/249/1998(H6N1))]
 gb|ABI92248.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/170/1999(H6N5))]
 gb|ABI92259.1|  matrix protein 1 [Influenza A virus (A/mallard/Alaska/256/2005(H3N8))]
 gb|ABI92270.1|  matrix protein 1 [Influenza A virus (A/pintail/Alaska/279/2005(H3N8))]
 dbj|BAF33063.1|  matrix protein 1 [Influenza A virus (A/Duck/Hokkaido/8/80 (H3N8))]
 gb|ABI94582.1|  matrix protein 1 [Influenza A virus (A/chicken/Netherlands/03010132/03(H7N7))]
 gb|ABI94761.1|  matrix protein 1 [Influenza A virus (A/chicken/Hubei/wi/1997(H5N1))]
 gb|ABI95174.1|  matrix protein 1 [Influenza A virus (A/gadwall/Ohio/37/1999(H6N2))]
 gb|ABI95207.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/322/1998(H7N3))]
 gb|ABI95475.1|  matrix protein 1 [Influenza A virus (A/pintail/Ohio/454/1987(H3N8))]
 gb|ABI96731.1|  matrix protein 1 [Influenza A virus (A/chicken/Hubei/wk/1997(H5N1))]
 gb|ABI97488.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/94/1989(H4N2))]
 gb|ABJ09097.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/264/1986(H3N8))]
 gb|ABJ09119.1|  matrix protein 1 [Influenza A virus (A/mallard/Alaska/715/2005(H3N8))]
 gb|ABJ09130.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/409/1988(H12N5))]
 gb|ABJ53428.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/66/1999(H1N1))]
 gb|ABJ53571.1|  matrix protein 1 [Influenza A virus (A/bufflehead/Ohio/246/1986(H11N2))]
 gb|ABK40635.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/265/1987(H1N9))]
 gb|ABK79938.1|  matrix protein 1 [Influenza A virus (A/pintail/Alaska/211/2005(H3N8))]
 gb|ABK80004.1|  matrix protein 1 [Influenza A virus (A/poultry/Italy/330/1997(H5N2))]
 gb|ABK80015.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/424/1988(H3N2))]
 gb|ABL67023.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/30/1986(H2N1))]
 gb|ABL67034.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/324/1988(H4N6))]
 gb|ABL67045.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/156/1990(H3N6))]
 gb|ABL67056.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/72/1999(H1N1))]
 gb|ABL67067.1|  matrix protein 1 [Influenza A virus (A/pintail/Ohio/25/1999(H1N1))]
 gb|ABL67078.1|  matrix protein 1 [Influenza A virus (A/pintail/Alaska/102/2005(H12N5))]
 gb|ABL67089.1|  matrix protein 1 [Influenza A virus (A/pintail/Alaska/310/2005(H4N6))]
 gb|ABL67100.1|  matrix protein 1 [Influenza A virus (A/mallard/Alaska/708/2005(H8N4))]
 gb|ABL67122.1|  matrix protein 1 [Influenza A virus (A/black duck/Ohio/194/1986(H11N1))]
 gb|ABL67133.1|  matrix protein 1 [Influenza A virus (A/longtail duck/Maryland/291/2005(H3N8))]
 gb|ABL67144.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/99/1989(H10N7))]
 gb|ABL67155.1|  matrix protein 1 [Influenza A virus (A/snow goose/Maryland/410/2005(H6N1))]
 gb|ABL67221.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/466/1987(H3N8))]
 gb|ABL67232.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/81/1999(H11N2))]
 gb|ABL67243.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/407/1987(H12N5))]
 gb|ABL67842.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/Ohio/454/1987(H3N8))]
 gb|ABL75564.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/31/1999(H3N2))]
 gb|ABL75575.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/203/1998(H6N2))]
 gb|ABM21950.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/175/1986(H2N1))]
 gb|ABM21961.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/118/1993(H1N1))]
 gb|ABM21983.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/658/2004(H7N3))]
 gb|ABM21994.1|  matrix protein 1 [Influenza A virus (A/snow goose/Maryland/353/2005(H6N1))]
 gb|ABM22005.1|  matrix protein 1 [Influenza A virus (A/snow goose/Maryland/364/2005(H6N1))]
 gb|ABM22049.1|  matrix protein 1 [Influenza A virus (A/poultry/Italy/382/1997(H5N2))]
 gb|ABM66854.1|  matrix protein 1 [Influenza A virus (A/pintail/Ohio/339/1987(H3N8))]
 gb|ABM66876.1|  matrix protein 1 [Influenza A virus (A/environment/Ohio/994/2005(H3N2))]
 gb|ABO37978.1|  matrix protein 1 [Influenza A virus (A/poultry/Italy/373/1997(H5N2))]
 gb|ABO51830.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/48/1986(H3N2))]
 gb|ABO51841.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/667/2002(H4N6))]
 gb|ABO51852.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/750/2002(H4N6))]
 gb|ABO51874.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/989/2002(H4N6))]
 gb|ABO51885.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/649/2002(H3N8))]
 gb|ABO51896.1|  matrix protein 1 [Influenza A virus (A/black duck/Maryland/834/2002(H4N8))]
 gb|ABO51907.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/655/2002(H4N6))]
 gb|ABO51929.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/668/2002(H4N6))]
 gb|ABO51940.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/671/2002(H4N6))]
 gb|ABO51951.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/686/2002(H4N2))]
 gb|ABO52006.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/881/2002(H6N2))]
 gb|ABO52039.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/907/2002(H1N6))]
 gb|ABO52061.1|  matrix protein 1 [Influenza A virus (A/black duck/Ohio/415/2001(H7N3))]
 gb|ABO52083.1|  matrix protein 1 [Influenza A virus (A/longtail duck/Maryland/295/2005(H10N8))]
 gb|ABO52094.1|  matrix protein 1 [Influenza A virus (A/common scoter/Maryland/297/2005(H10N8))]
 gb|ABO52105.1|  matrix protein 1 [Influenza A virus (A/environment/Ohio/1007/2005(H1N1))]
 gb|ABO52116.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/122/1989(H10N7))]
 gb|ABO52127.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/Ohio/35/1986(H3N8))]
 gb|ABO52171.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/101/1993(H11N9))]
 gb|ABO52193.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/129/1989(H4N6))]
 gb|ABO52215.1|  matrix protein 1 [Influenza A virus (A/environment/Ohio/1001/2005(H3N2))]
 gb|ABO52380.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/37/1986(H2N1))]
 gb|ABO52391.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/399/1987(H11N9))]
 gb|ABO52402.1|  matrix protein 1 [Influenza A virus (A/mallard/Missouri/MO130/2005(H11N3))]
 gb|ABO52413.1|  matrix protein 1 [Influenza A virus (A/environment/Delaware/232/2005(H11N8))]
 gb|ABO52435.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1747/2005(H11N2))]
 gb|ABO52446.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1844/2005(H11N9))]
 gb|ABO52457.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/1851/2005(H11N1))]
 gb|ABO52501.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/178/1990(H4N6))]
 gb|ABO52512.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/1339/2005(H4N6))]
 gb|ABO52534.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1324/2005(H4N6))]
 gb|ABO52545.1|  matrix protein 1 [Influenza A virus (A/american black duck/Ohio/1823/2005(H11N9))]
 gb|ABO52556.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/94/1993(H11N3))]
 gb|ABO52567.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/681/2005(H3N2))]
 gb|ABO52578.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/691/2005(H3N2))]
 gb|ABO52589.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/631/2005(H3N2))]
 gb|ABO52600.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1176/2005(H3N6))]
 gb|ABO52611.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/1135/2005(H12N5))]
 gb|ABO52622.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/1153/2005(H12N5))]
 gb|ABO52633.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1165/2005(H3N8))]
 gb|ABO52644.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1289/2005(H3N8))]
 gb|ABO52655.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1324/2005(H4N6))]
 gb|ABO52666.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/1241/2005(H4N6))]
 gb|ABO52677.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/1801/2005(H3N8))]
 gb|ABO52688.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1292/2005(H4N6))]
 gb|ABO52732.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/1980(H5N2))]
 gb|ABO52754.1|  matrix protein 1 [Influenza A virus (A/mallard/Italy/3401/2005(H5N1))]
 gb|ABO52776.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3675/1999(H7N1))]
 gb|ABO64344.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/181/1986(H3N1))]
 gb|ABO76914.1|  matrix protein 1 [Influenza A virus (A/pintail/Alaska/49/2005(H3N8))]
 gb|ABO76925.1|  matrix protein 1 [Influenza A virus (A/environment/Delaware/235/2005(H11N6))]
 gb|ABO76936.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/96/1993(H11N9))]
 gb|ABO76947.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/615/2005(H3N2))]
 gb|ABO76958.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/710/2005(H3N2))]
 gb|ABO76969.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/1124/2005(H11N9))]
 gb|ABO76980.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/2022/2005(H6N8))]
 gb|ABO77024.1|  matrix protein 1 [Influenza A virus (A/quail/Italy/4610/2003(H7N2))]
 gb|ABO77046.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/1258/2005(H5N2))]
 dbj|BAF56171.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/447/2000(H5N3))]
 gb|ABP49196.1|  matrix protein 1 [Influenza A virus (A/black duck/Ohio/239/1986(H11N9))]
 gb|ABP49207.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/421/1987(H7N8))]
 gb|ABP49229.1|  matrix protein 1 [Influenza A virus (A/mallard/Delaware/418/2005(H7N3))]
 gb|ABP49240.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/397/1986(H11N9))]
 gb|ABP49251.1|  matrix protein 1 [Influenza A virus (A/black duck/Ohio/161/1999(H11N9))]
 gb|ABP49262.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/173/1990(H11N9))]
 gb|ABP49273.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/496/1987(H11N9))]
 gb|ABP49295.1|  matrix protein 1 [Influenza A virus (A/mallard/Missouri/MO32/2005(H11N9))]
 gb|ABP49531.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/184/1986(Mixed))]
 gb|ABP88950.1|  matrix protein 1 [Influenza A virus (A/mallard/Xuyi/7/2004)]
 gb|ABP88956.1|  matrix protein 1 [Influenza A virus (A/Baikal Teal/Hongze/14/2005)]
 dbj|BAF57020.1|  matrix protein 1 [Influenza A virus (A/duck/Mongolia/54/2001(H5N2))]
 gb|ABQ01246.1|  matrix protein 1 [Influenza A virus (A/environment/Delaware/234/2005(H11N8))]
 gb|ABQ01257.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/1387/2005(H6N2))]
 gb|ABQ01268.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/340/1987(H11N9))]
 gb|ABQ01279.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/1131/2005(H12N5))]
 gb|ABQ01301.1|  matrix protein 1 [Influenza A virus (A/white-winged scoter/Maryland/301/2005(H4N6))]
 emb|CAJ12151.1|  matrix protein M1 [Influenza A virus (A/duck/France/05054a/2005(H5N3))]
 emb|CAJ12153.1|  matrix protein M1 [Influenza A virus (A/duck/France/05056a/2005(H5N2))]
 emb|CAJ12155.1|  matrix protein M1 [Influenza A virus (A/duck/France/05057b/2005(H5N2))]
 gb|ABQ84481.1|  matrix protein [Influenza A virus (A/goose/Hong Kong/23/1978(H5N3))]
 gb|ABQ84482.1|  matrix protein [Influenza A virus (A/duck/Hong Kong/312/1978(H5N3))]
 gb|ABQ84485.1|  matrix protein [Influenza A virus (A/duck/Hong Kong/698/1979(H5N3))]
 gb|ABQ84487.1|  matrix protein [Influenza A virus (A/duck/Yunnan/435/2002(H5N3))]
 gb|ABQ84488.1|  matrix protein [Influenza A virus (A/duck/Jiang Xi/6146/2003(H5N3))]
 gb|ABQ84490.1|  matrix protein [Influenza A virus (A/migratory duck/Hong Kong/MP206/2004(H5N2))]
 gb|ABQ84491.1|  matrix protein [Influenza A virus (A/migratory duck/Jiang Xi/13487/2005(H5N3))]
 gb|ABQ84493.1|  matrix protein [Influenza A virus (A/mallard/Italy/1980/1993(H5N2))]
 gb|ABQ84494.1|  matrix protein [Influenza A virus (A/chicken/Italy/312/1997(H5N2))]
 gb|ABQ84495.1|  matrix protein [Influenza A virus (A/chicken/Italy/9097/1997(H5N9))]
 gb|ABQ84496.1|  matrix protein [Influenza A virus (A/turkey/Italy/392/1997(H5N2))]
 gb|ABQ84498.1|  matrix protein [Influenza A virus (A/mallard/Italy/37/2002(H5N3))]
 gb|ABQ84501.1|  matrix protein [Influenza A virus (A/wild duck/Shantou/1737/2000(H6N8))]
 gb|ABQ84503.1|  matrix protein [Influenza A virus (A/wild duck/Shantou/1411/2000(H11N3))]
 gb|ABQ84505.1|  matrix protein [Influenza A virus (A/duck/Jiang Xi/1850/2005(H5N2))]
 gb|ABQ84506.1|  matrix protein [Influenza A virus (A/duck/Jiang Xi/197820/2003(H5N3))]
 gb|ABQ84507.1|  matrix protein [Influenza A virus (A/migratory duck/Hong Kong/MPS180/2003(H4N6))]
 gb|ABQ84508.1|  matrix protein [Influenza A virus (A/migratory duck/Hong Kong/MP2437/2003(H6N1))]
 gb|ABQ84509.1|  matrix protein [Influenza A virus (A/migratory duck/Hong Kong/MP2553/2003(H8N4))]
 gb|ABQ84510.1|  matrix protein [Influenza A virus (A/migratory duck/Jiang Xi/7231/2004(H10N5))]
 gb|ABQ84511.1|  matrix protein [Influenza A virus (A/migratory duck/Jiang Xi/6568/2004(H4N6))]
 gb|ABQ84512.1|  matrix protein [Influenza A virus (A/migratory duck/Jiang Xi/8624/2004(H6N2))]
 gb|ABQ96126.1|  matrix protein 1 [Influenza A virus (A/spotbill duck/Xuyi/9/2005)]
 gb|ABR15787.1|  matrix protein 1 [Influenza A virus (A/poultry/Italy/367/1997(H5N2))]
 emb|CAJ12149.1|  matrix protein M1 [Influenza A virus (A/duck/France/02166/2002(H5N3))]
 gb|ABR28527.1|  matrix protein 1 [Influenza A virus (A/poultry/Italy/365/1997(H5N2))]
 gb|ABR37309.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Ohio/1292/2005(H4N6))]
 gb|ABR37331.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/1325/2005(H5N2))]
 gb|ABR37353.1|  matrix protein 1 [Influenza A virus (A/teal/Italy/3812/2005(H5N3))]
 gb|ABR37397.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/1082/1999(H7N1))]
 gb|ABR37408.1|  matrix protein 1 [Influenza A virus (A/chicken/Queensland/1994(H7N3))]
 gb|ABR37419.1|  matrix protein 1 [Influenza A virus (A/chicken/New South Wales/2/1997(H7N4))]
 gb|ABR37430.1|  matrix protein 1 [Influenza A virus (A/chicken/New South Wales/327/1997(H7N4))]
 gb|ABR37441.1|  matrix protein 1 [Influenza A virus (A/emu/New South Wales/775/1997(H7N4))]
 gb|ABR37452.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/1717/2005(H3N6))]
 gb|ABR37463.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1175/2005(H3N8))]
 gb|ABR37474.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1172/2005(H3N6))]
 gb|ABR37485.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/712/2005(H3N2))]
 gb|ABR37496.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/261/2006(H7N3))]
 gb|ABR37507.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/267/2006(H7N3))]
 gb|ABR37721.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/22A/1998(H5N9))]
 gb|ABS70306.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/161/2002(H1N1))]
 gb|ABS70317.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/163/2002(H1N1))]
 gb|ABS70327.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/168/2002(H1N1))]
 gb|ABS70338.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/170/2002(H1N1))]
 gb|ABS70348.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/352/2002(H1N1))]
 gb|ABS70358.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/358/2002(H1N1))]
 gb|ABS70368.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/369/2002(H1N1))]
 gb|ABS70379.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/382/2002(H1N1))]
 gb|ABS70390.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/390/2002(H1N1))]
 gb|ABS70401.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/403/2002(H1N1))]
 gb|ABS70412.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/406/2002(H1N1))]
 gb|ABS70428.1|  matrix protein 1 [Influenza A virus (A/duck/NY/13152-13/1994(H1N1))]
 gb|ABS70439.1|  matrix protein 1 [Influenza A virus (A/duck/NJ/7717-70/1995(H1N1))]
 gb|ABS89311.1|  matrix protein 1 [Influenza A virus (A/duck/Italy/775/2004(H5N3))]
 gb|ABS89322.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/977/1999(H7N1))]
 gb|ABS89355.1|  matrix protein 1 [Influenza A virus (A/starling/Victoria/1985(H7N7))]
 gb|ABS89366.1|  matrix protein 1 [Influenza A virus (A/chicken/Victoria/1976(H7N7))]
 gb|ABS89377.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/1983/2005(H6N8))]
 gb|ABS89388.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1158/2005(H3N8))]
 gb|ABS89399.1|  matrix protein 1 [Influenza A virus (A/mallard.Maryland/708/2005(H3N2))]
 gb|ABS89410.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/566/2006(H7N9))]
 gb|ABS89476.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4482/1999(H7N1))]
 gb|ABS89487.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4295/1999(H7N1))]
 gb|ABS89498.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3185/1999(H7N1))]
 gb|ABS89509.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3488/1999(H7N1))]
 gb|ABU53962.1|  matrix protein 1 [Influenza A virus (A/mallard/SanJiang/113/2006(H6N2))]
 dbj|BAF76010.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/Vac-3/2007(H5N1))]
 gb|ABV01124.1|  matrix protein 1 [Influenza A virus (A/chicken/Victoria/1/1985(H7N7))]
 gb|ABV01146.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1174/2005(H3N6))]
 gb|ABV01157.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/763/2006(H11N9))]
 gb|ABV01168.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1101/2006(H4N6))]
 gb|ABV01179.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4644/1999(H7N1))]
 gb|ABV01212.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4294/1999(H7N1))]
 gb|ABV01234.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/4301/1999(H7N1))]
 gb|ABV01245.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3489/1999(H7N1))]
 gb|ABV01256.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/3560/1999(H7N1))]
 gb|ABV01267.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/2715/1999(H7N1))]
 gb|ABV01278.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/2732/1999(H7N1))]
 gb|ABV01289.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/1265/1999(H7N1))]
 gb|ABV01300.1|  matrix protein 1 [Influenza A virus (A/sharp-tailed sandpiper/Australia/6/2004(H11N9))]
 gb|ABV47732.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/163/2004(H9N2))]
 gb|ABV47754.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/7488/2004(H9N2))]
 gb|ABW23587.1|  matrix protein 1 [Influenza A virus (A/dunlin/Barrow/65/2005(H6N1))]
 gb|ABW94103.1|  matrix protein 1 [Influenza A virus (A/Chicken/NY/14714-2/1999(H7N3))]
 gb|ABW97484.1|  matrix protein 1 [Influenza A virus (A/turkey/WI/1966(H9N2))]
 gb|ABX88800.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/182/2006(H5N2))]
 gb|ABX88811.1|  matrix protein 1 [Influenza A virus (A/Eurasian coot/Western 
Australia/2727/1979(H6N2))]
 gb|ABX88844.1|  matrix protein 1 [Influenza A virus (A/black duck/Western Australia/4954/1983(H3N8))]
 gb|ABY26178.1|  matrix protein 1 [Influenza A virus (A/duck/Jiangxi/1742/03(H7N7))]
 gb|ABY26184.1|  matrix protein 1 [Influenza A virus (A/mallard/Italy/250/02(H7N1))]
 gb|ABY26186.1|  matrix protein 1 [Influenza A virus (A/mallard/Italy/299/05(H7N7))]
 gb|ABY26188.1|  matrix protein 1 [Influenza A virus (A/duck/Jiangxi/1814/03(H7N7))]
 gb|ABY26190.1|  matrix protein 1 [Influenza A virus (A/duck/Jiangxi/1786/03(H7N7))]
 gb|ABY26192.1|  matrix protein 1 [Influenza A virus (A/duck/Jiangxi/1760/03(H7N7))]
 gb|ABY51493.1|  matrix protein 1 [Influenza A virus (A/black duck/Perth/699/1978(H3N8))]
 gb|ABY51515.1|  matrix protein 1 [Influenza A virus (A/wedge-tailed shearwater/Western 
Australia/405/1977(H3N8))]
 gb|ABY81637.1|  matrix protein 1 [Influenza A virus (A/duck/Malaysia/F118-08-04/2004(H5N2))]
 gb|ACA04564.1|  matrix protein 1 [Influenza A virus (A/sharp-tailed sandpiper/Australia/10/2004(H11N9))]
 gb|ACA04608.1|  matrix protein 1 [Influenza A virus (A/mallard/Missouri/209/2006(H11N9))]
 gb|ACA04619.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Ohio/1864/2006(H3N8))]
 gb|ACA14215.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/CN-2/2004(H3N2))]
 gb|ACA14217.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/CN-3/2005(H3N1))]
 gb|ACA14219.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/CN-4/2006(H3N3))]
 gb|ACA14221.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/JN-1/2005(H3N8))]
 gb|ACA14223.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/JN-2/2006(H3N2))]
 gb|ACA14225.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/KN-1/2004(H3N8))]
 gb|ACA14229.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/KN-3/2005(H3N8))]
 gb|ACA14231.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/KN-4/2005(H3N8))]
 gb|ACA14233.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/KN-5/2006(H3N8))]
 gb|ACA14235.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM01/2004(H3N2))]
 gb|ACA14237.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM03/2004(H3N2))]
 gb|ACA14239.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM09/2004(H3N2))]
 gb|ACA14241.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM17/2004(H3N2))]
 gb|ACA14243.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM18/2004(H3N2))]
 gb|ACA14245.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM22/2005(H3N2))]
 gb|ACA14247.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM23/2005(H3N2))]
 gb|ACA14249.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM36/2005(H3N6))]
 gb|ACA14251.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM38/2005(H3N6))]
 gb|ACA14253.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM39/2005(H3N2))]
 gb|ACA14257.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM44/2005(H3N2))]
 gb|ACA14259.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM56/2005(H3N2))]
 gb|ACA14263.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM66/2006(H3N2))]
 gb|ACA14265.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM67/2006(H3N2))]
 gb|ACA14267.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM86/2006(H3N2))]
 gb|ACA14269.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM88/2006(H3N2))]
 gb|ACA14271.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM91/2006(H3N2))]
 gb|ACA14273.1|  matrix protein 1 [Influenza A virus (A/duck/Korea/LPM92/2006(H3N2))]
 gb|ACA25312.1|  matrix protein M1 [Influenza A virus (A/Canada goose/BC/3752/2007(H7N3))]
 gb|ACA25322.1|  matrix protein M1 [Influenza A virus (A/American black duck/NB/2538/2007(H7N3))]
 gb|ACA47431.1|  matrix protein 1 [Influenza A virus (A/duck/Shantou/1101/2001(H5N1))]
 gb|ACA61632.1|  matrix protein 1 [Influenza A virus (A/duck/Malaysia/F189/2004(H5N2))]
 dbj|BAG13020.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/120/2001(H6N2))]
 dbj|BAG15936.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/39/2003(H3N8))]
 dbj|BAG15937.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/108/2003(H6N8))]
 dbj|BAG15938.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/124/2003(H8N4))]
 dbj|BAG15939.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/143/2003(H7N1))]
 dbj|BAG15942.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/139/2004(H6N8))]
 dbj|BAG15945.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/257/2004(H6N1))]
 dbj|BAG15946.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/W5/2004(H4N6))]
 dbj|BAG15951.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/12/2005(H3N2))]
 dbj|BAG15953.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/260/2005(H8N4))]
 dbj|BAG15954.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/W70/2005(H3N8))]
 dbj|BAG15955.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/56/2001(H3N8))]
 dbj|BAG15957.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/W259/2005(H2N5))]
 dbj|BAG15958.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/W268/2005(H6N1))]
 dbj|BAG15972.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/W206/2006(H6N1))]
 dbj|BAG15973.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/36/2007(H12N5))]
 dbj|BAG15981.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/156/2006(H11N9))]
 dbj|BAG15983.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/95/01(H2N2))]
 gb|AAT70613.2|  matrix protein 1 [Influenza A virus (A/WDk/ST/988/2000(H4N9))]
 gb|ACC61822.1|  matrix protein 1 [Influenza A virus (A/duck/Italy/4609/2003(H7N2))]
 gb|ACC63253.1|  matrix protein 1 [Influenza A virus (A/environment/Maryland/1631/2006(H7N3))]
 gb|ACD12175.1|  matrix protein 1 [Influenza A virus (A/duck/Hong Kong/702/1979(H9N2))]
 gb|ACD76862.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/371/2003(H5N2))]
 dbj|BAG38704.1|  matrix protein 1 [Influenza A virus (A/chicken/Netherlands/2586/2003(H7N7))]
 gb|ACD85144.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/350/2002(H1N1))]
 gb|ACD85419.1|  matrix protein 1 [Influenza A virus (A/equine/Uruguay/1/1963(H3N8))]
 gb|ACD88495.1|  matrix protein 1 [Influenza A virus (A/duck/NY/6874/1978(H3N2))]
 gb|ACD88506.1|  matrix protein 1 [Influenza A virus (A/gull/MD/19/1977(H2N9))]
 gb|ACD88535.1|  matrix protein 1 [Influenza A virus (A/pheasant/NJ/9804564/1998(H5N2))]
 gb|ACD88682.1|  matrix protein 1 [Influenza A virus (A/quail/IN/38685/1993(H1N1))]
 gb|ACE76540.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1005/2007(H10N3))]
 gb|ACE76562.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1201/2007(H3N5))]
 gb|ACE76584.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1370/2007(H10N3))]
 gb|ACE76595.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF268/2007(H6N2))]
 gb|ACE76606.1|  matrix protein 1 [Influenza A virus (A/American wigeon/California/HKWF371/2007(H6N5))]
 gb|ACE76617.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF383/2007(H6N1))]
 gb|ACE76628.1|  matrix protein 1 [Influenza A virus (A/northern pintail/California/HKWF792/2007(H3N8))]
 gb|ACE76639.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF979/2007(H3N3))]
 gb|ACE78944.1|  matrix protein 1 [Influenza A virus (A/Anas platyrhynchos/Altai/1285/1991(H5N3))]
 gb|ACE78960.1|  matrix protein 1 [Influenza A virus (A/Anas querquedula/Astrakhan/3091/2002(H4N8))]
 gb|ACE79009.1|  matrix protein 1 [Influenza A virus (A/common tern/Buryatiya/1901/2000(H4N6))]
 gb|ACE79015.1|  matrix protein 1 [Influenza A virus (A/pochard/Buryatiya/1903/2000(H4N6))]
 gb|ACE79017.1|  matrix protein 1 [Influenza A virus (A/ruddy sheldrake/Buryatiya/1882/2000(H4N6))]
 gb|ACE79019.1|  matrix protein 1 [Influenza A virus (A/shoveler/Buryatiya/1898/2000(H4N6))]
 gb|ACE79021.1|  matrix protein 1 [Influenza A virus (A/duck/Primorie/2621/01(H5N2))]
 gb|ACE81695.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF115/2007(H6N1))]
 gb|ACE81706.1|  matrix protein 1 [Influenza A virus (A/bufflehead/California/HKWF205/2007(H4N8))]
 gb|ACE81717.1|  matrix protein 1 [Influenza A virus (A/American wigeon/California/HKWF295/2007(H6N5))]
 gb|ACE81728.1|  matrix protein 1 [Influenza A virus (A/American wigeon/California/HKWF450/2007(H4N7))]
 gb|ACE81739.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF611/2007(H11N9))]
 gb|ACE81750.1|  matrix protein 1 [Influenza A virus (A/ring-necked duck/California/HKWF662/2007(H6N1))]
 gb|ACF08322.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM19/2005(H3N2))]
 gb|ACF08358.1|  matrix protein 1 [Influenza A virus (A/chicken/Korea/LPM87/2006(H9N2))]
 gb|ACF08366.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w6/2005(H6N8))]
 gb|ACF08368.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w9/2005(H6N2))]
 gb|ACF08370.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w14/2005(H6N2))]
 gb|ACF08372.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w16/2005(H5N3))]
 gb|ACF08376.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w28/2005(H4N6))]
 gb|ACF08380.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w74/2005(H5N2))]
 gb|ACF08384.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w81/2005(H5N2))]
 gb|ACF08388.1|  matrix protein 1 [Influenza A virus (A/aquatic bird/Korea/w107/2006(H5N3))]
 gb|ACF22431.1|  matrix protein 1 [Influenza A virus (A/duck/Tasmania/277/2007(H7N2))]
 gb|ACF24877.1|  matrix protein 1 [Influenza A virus (A/duck/PA/486/1969(H6N1))]
 gb|ACF24977.1|  matrix protein 1 [Influenza A virus (A/herring gull/DE/677/1988(H2N8))]
 gb|ACF25017.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/1444/2000(H12N5))]
 gb|ACF25026.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/1602/2001(H10N7))]
 gb|ACF25125.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/02-375/2002(H1N1))]
 gb|ACF25136.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/02-359/2002(H1N1))]
 gb|ACF25147.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/02-184/2002(H1N1))]
 gb|ACF25158.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/02-181/2002(H1N1))]
 gb|ACF25169.1|  matrix protein 1 [Influenza A virus (A/pintail/MN/479/1999(H3N6))]
 gb|ACF25180.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/515/2000(H3N6))]
 gb|ACF25191.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/99/2000(H3N6))]
 gb|ACF25202.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/259/1999(H3N6))]
 gb|ACF25213.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/330/1999(H3N1))]
 gb|ACF25224.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/380/1999(H3N2))]
 gb|ACF25235.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/581/2000(H12N5))]
 gb|ACF25246.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/109/2000(H11N9))]
 gb|ACF25256.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/107/2000(H11N9))]
 gb|ACF25267.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/42/2000(H11N9))]
 gb|ACF25278.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/2002/2001(H10N7))]
 gb|ACF25289.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/1956/2001(H10N7))]
 gb|ACF25300.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/1605/2001(H10N7))]
 gb|ACF25322.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/823/2001(H10N7))]
 gb|ACF25333.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/350/2004(H10N7))]
 gb|ACF25344.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/238/2004(H10N7))]
 gb|ACF25355.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/203/2004(H10N7))]
 gb|ACF25366.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/167/2004(H10N7))]
 gb|ACF25377.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/1529/2001(H10N7))]
 gb|ACF25388.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/1450/2001(H10N7))]
 gb|ACF25399.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/323/2004(H10N7))]
 gb|ACF25410.1|  matrix protein 1 [Influenza A virus (A/red knot/NJ/1443/2001(H10N7))]
 gb|ACF25432.1|  matrix protein 1 [Influenza A virus (A/red knot/DE/1587/2001(H10N7))]
 gb|ACF25443.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/TX/56/2000(H10N7))]
 gb|ACF25465.1|  matrix protein 1 [Influenza A virus (A/blue winged teal/LA/B228/1986(H1N1))]
 gb|ACF25476.1|  matrix protein 1 [Influenza A virus (A/mallard/WI/42/1975(H5N2))]
 gb|ACF25551.1|  matrix protein 1 [Influenza A virus (A/guinea fowl/NJ/8848-18/1998(H3N2))]
 gb|ACF25561.1|  matrix protein 1 [Influenza A virus (A/chicken/NY/11602-12/1998(H3N2))]
 gb|ACF25625.1|  matrix protein 1 [Influenza A virus (A/emu/NY/12716/1994(H5N9))]
 gb|ACF25644.1|  matrix protein 1 [Influenza A virus (A/pheasant/MD/4457/1993(H5N2))]
 gb|ACF25654.1|  matrix protein 1 [Influenza A virus (A/rhea/TX/39923/1993(H5N2))]
 gb|ACF25815.1|  matrix protein 1 [Influenza A virus (A/turkey/TX/1-40-82/1982(H5N2))]
 gb|ACF33643.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/105/2000(H5N5))]
 gb|ACF33653.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/479/2000(H5N3))]
 gb|ACF33663.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/113/2000(H5N2))]
 gb|ACF33685.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/269/1999(H4N6))]
 gb|ACF33696.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/160/1999(H4N6))]
 gb|ACF33707.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/158/2000(H3N9))]
 gb|ACF33751.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/LA/9GW/1987(H11N9))]
 gb|ACF36762.1|  matrix protein 1 [Influenza A virus (A/turkey/CA/358533/2005(H4N8))]
 gb|ACF36826.1|  matrix protein 1 [Influenza A virus (A/mallard/Yan chen/2005(H4N6))]
 gb|ACF40972.1|  matrix protein 1 [Influenza A virus (A/turkey/England/50-92/91(H5N1))]
 gb|ACF47401.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1021/2007(H3N7))]
 gb|ACF47412.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1046/2007(H3N5))]
 gb|ACF47434.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1131/2007(H3N5))]
 gb|ACF47456.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1199/2007(H3N5))]
 gb|ACF47478.1|  matrix protein 1 [Influenza A virus (A/mallard/California/HKWF1971/2007(H7N7))]
 gb|ACF47511.1|  matrix protein 1 [Influenza A virus (A/ring necked duck/California/HKWF402/2007(H6N1))]
 gb|ACF47533.1|  matrix protein 1 [Influenza A virus (A/American wigeon/California/HKWF42/2007(H6N1))]
 gb|ACF47544.1|  matrix protein 1 [Influenza A virus (A/ring necked duck/California/HKWF515/2007(H6N1))]
 gb|ACF47555.1|  matrix protein 1 [Influenza A virus (A/American wigeon/California/HKWF541/2007(H6N5))]
 gb|ACF47566.1|  matrix protein 1 [Influenza A virus (A/American green-winged 
teal/California/HKWF609/2007(H5N2))]
 gb|ACF74215.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1203/2007(H8N4))]
 gb|ACF74225.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF1325/2007(H8N4))]
 gb|ACF74235.1|  matrix protein 1 [Influenza A virus (A/greater white fronted 
goose/California/HKWF446/2007(H10N7))]
 gb|ACF74254.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF592/2007(H10N7))]
 gb|ACF74264.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF848/2007(H3N7))]
 gb|ACG59811.1|  matrix protein 1 [Influenza A virus (A/turkey/TX/10-49-89/1989(H9N2))]
 gb|ACG59822.1|  matrix protein 1 [Influenza A virus (A/turkey/TX/4-1-81/1981(H9N2))]
 gb|ACG59832.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/DE/313/2003(H5N2))]
 gb|ACG59843.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/199/2003(H1N1))]
 gb|ACG59853.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/11/2003(H1N1))]
 gb|ACG59863.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/185/2003(H5N2))]
 gb|ACG59874.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/898/2002(H5N2))]
 gb|ACG59884.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/865/2002(H5N2))]
 gb|ACG59929.1|  matrix protein 1 [Influenza A virus (A/emu/TX/25414/1995(H7N2))]
 gb|ACI16698.1|  matrix protein 1 [Influenza A virus (A/mallard/Italy/4223-2/2006(H5N2))]
 gb|ACI40918.1|  matrix protein 1 [Influenza A virus (A/mallard/ZhaLong/88/2004(H4N6))]
 gb|ACI40979.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/53/2003(H1N1))]
 gb|ACI40990.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/42/2003(H1N1))]
 gb|ACI41001.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/41/2003(H1N1))]
 gb|ACI41012.1|  matrix protein 1 [Influenza A virus (A/mallard/MD/26/2003(H1N1))]
 gb|ACI41057.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/14/1998(H2N3))]
 gb|ACI41068.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/1/2000(H5N2))]
 gb|ACI41101.1|  matrix protein 1 [Influenza A virus (A/blue winged teal/TX/75/2002(H1N3))]
 gb|ACI41112.1|  matrix protein 1 [Influenza A virus (A/blue winged teal/TX/34/2002(H1N3))]
 gb|ACI90139.1|  matrix protein 1 [Influenza A virus (A/least sandpiper/South 
Central Alaska/2/2007(H4N8))]
 gb|ACI90150.1|  matrix protein 1 [Influenza A virus (A/least sandpiper/South 
Central Alaska/3/2007(H4N8))]
 gb|ACI90161.1|  matrix protein 1 [Influenza A virus (A/mallard/Interior Alaska/2/2007(H3N8))]
 gb|ACI90172.1|  matrix protein 1 [Influenza A virus (A/American widgeon/Interior 
Alaska/1/2007(H3N8))]
 gb|ACI90183.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/Interior 
Alaska/1/2007(H3N8))]
 gb|ACJ04577.1|  matrix protein 1 [Influenza A virus (A/least sandpiper/South 
Central Alaska/1/2007(H4N8))]
 gb|ACJ04588.1|  matrix protein 1 [Influenza A virus (A/mallard/Interior Alaska/1/2007(H3N8))]
 gb|ACJ04612.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/California/HKWF216/2007(H6N1))]
 gb|ACJ10017.1|  matrix protein 1 [Influenza A virus (A/Muscovy duck/New York/62095-1/2006(H5N2))]
 gb|ACJ14446.1|  matrix protein 1 [Influenza A virus (A/duck/Italy/69238/2007(H1N1))]
 gb|ACJ14457.1|  matrix protein 1 [Influenza A virus (A/duck/Italy/194659/2006(H3N2))]
 gb|ACJ14468.1|  matrix protein 1 [Influenza A virus (A/duck/Italy/281904/2006(H1N1))]
 gb|ACJ14479.1|  matrix protein 1 [Influenza A virus (A/goose/Italy/296426/2003(H1N1))]
 emb|CAJ43169.1|  matrix protein 1 [Influenza A virus (A/sentinel duck/France/43/2000(H6N2))]
 emb|CAJ43171.1|  matrix protein 1 [Influenza A virus (A/sentinel duck/France/92/2000(H6N2))]
 emb|CAJ43173.1|  matrix protein 1 [Influenza A virus (A/mallard/France/2515/2001(H3N8))]
 emb|CAJ43175.1|  matrix protein 1 [Influenza A virus (A/mallard/France/2525/2001(H7N1))]
 emb|CAJ43179.1|  matrix protein 1 [Influenza A virus (A/teal/France/2546/2001(H1N3))]
 emb|CAJ43181.1|  matrix protein 1 [Influenza A virus (A/sentinel duck/France/2060/2001(H1N1))]
 emb|CAJ43183.1|  matrix protein 1 [Influenza A virus (A/turkey/France/01019/2001(H6N8))]
 emb|CAJ43187.1|  matrix protein 1 [Influenza A virus (A/sentinel duck/France/1043/2002(H9N2))]
 emb|CAJ43189.1|  matrix protein 1 [Influenza A virus (A/sentinel duck/France/1080/2002(H9N2))]
 emb|CAJ43191.1|  matrix protein 1 [Influenza A virus (A/mallard/France/691/2002(H1N1))]
 emb|CAJ43193.1|  matrix protein 1 [Influenza A virus (A/mallard/France/710/2002(H1N1))]
 gb|ACJ53832.1|  matrix protein 1 [Influenza A virus (A/mute swan/Aktau/1460/2006(H5N1))]
 gb|ACK28198.1|  matrix protein 1 [Influenza A virus (A/least sandpiper/South 
Central Alaska/4/2007(H4N8))]
 gb|ACK28209.1|  matrix protein 1 [Influenza A virus (A/northern pintail/Interior 
Alaska/1/2007(H4N6))]
 gb|ACK28220.1|  matrix protein 1 [Influenza A virus (A/green-winged teal/Interior 
Alaska/1/2007(H3N8))]
 gb|ACK43328.1|  matrix protein 1 [Influenza A virus (A/blue goose/WI/711/1975(H5N2))]
 gb|ACK43351.1|  matrix protein 1 [Influenza A virus (A/mallard/MN/327/1999(H4N8))]
 gb|ACK43393.1|  matrix protein 1 [Influenza A virus (A/mallard/Minnesota/190/1999(H3N8))]
 gb|ACK43401.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/NJ/631/2002(H11N1))]
 gb|ACK43422.1|  matrix protein 1 [Influenza A virus (A/shorebird/DE/1346/2001(H5N7))]
 dbj|BAF02911.2|  matrix protein 1 [Influenza A virus (A/duck/Mongolia/47/2001(H7N1))]
 dbj|BAH03376.1|  matrix protein 1 [Influenza A virus (A/duck/Mongolia/867/2002(H7N1))]
 gb|ACK99345.1|  matrix protein 1 [Influenza A virus (A/environment/New York/11653-1/2005(H5N2))]
 gb|ACK99356.1|  matrix protein 1 [Influenza A virus (A/mallard/Wisconsin/944/1982(H5N2))]
 gb|ACK99367.1|  matrix protein 1 [Influenza A virus (A/shorebird/Delaware Bay/560/2006(H7N3))]
 gb|ACK99378.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/108/2007(H7N3))]
 gb|ACK99389.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/121/2007(H7N3))]
 gb|ACK99400.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/123/2007(H7N3))]
 dbj|BAH03468.1|  matrix protein 1 [Influenza A virus (A/duck/Hokkaido/49/98(H9N2))]
 gb|ACM17916.1|  matrix protein 1 [Influenza A virus (A/blue-winged teal/Manitoba/13436/2005(H3N8))]
 gb|ACM18015.1|  matrix protein 1 [Influenza A virus (A/laughing gull/Delaware 
Bay/6/2006(H7N3))]
 gb|ACM18048.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/283/2006(H7N3))]
 gb|ACM66676.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/316/2003(H2N3))]
 gb|ACM66687.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/314/2003(H2N3))]
 gb|ACM66698.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/296/2003(H2N3))]
 gb|ACM66709.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/234/2001(H2N3))]
 gb|ACM66720.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/233/2001(H2N3))]
 gb|ACM66731.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/232/2001(H2N3))]
 gb|ACM66742.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/231/2001(H2N3))]
 gb|ACM66753.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/228/2001(H2N3))]
 gb|ACM66764.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/226/2001(H2N3))]
 gb|ACM66775.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/897/2004(H5N2))]
 gb|ACM66786.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/365/2003(H2N1))]
 gb|ACM66797.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/363/2003(H2N1))]
 gb|ACM66808.1|  matrix protein 1 [Influenza A virus (A/mallard/Ohio/362/2003(H2N1))]
 gb|ACM66819.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/319/2003(H2N3))]
 gb|ACM66830.1|  matrix protein 1 [Influenza A virus (A/mallard/Maryland/301/2003(H2N3))]
 gb|ACN37868.1|  matrix protein 1 [Influenza A virus (A/mallard/Bavaria/1/2005(H5N2))]
 gb|ACN37870.1|  matrix protein 1 [Influenza A virus (A/mallard/Bavaria/3/2006(H10N7))]
 gb|ACO25303.1|  matrix protein 1 [Influenza A virus (A/northern shoveler/Interior 
Alaska/1/2007(H12N5))]
 gb|ACO25314.1|  matrix protein 1 [Influenza A virus (A/mallard/Interior Alaska/3/2007(H3N8))]
 gb|ACO25325.1|  matrix protein 1 [Influenza A virus (A/northern pintail/Interior 
Alaska/2/2007(H4N8))]
 gb|ACO25336.1|  matrix protein 1 [Influenza A virus (A/mallard/Interior Alaska/4/2007(H3N8))]
 gb|ACO25347.1|  matrix protein 1 [Influenza A virus (A/American green-winged 
teal/Interior Alaska/3/2007(H3N8))]
 gb|ACO95625.1|  matrix protein 1 [Influenza A virus (A/unknown/New York/78436/2006(H5N2))]
 gb|ACO95636.1|  matrix protein 1 [Influenza A virus (A/unknown/New York/89909/2006(H5N2))]
 gb|ACO95647.1|  matrix protein 1 [Influenza A virus (A/avian/Delaware Bay/226/2006(H7N3))]
 gb|ACO95658.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/262/2006(H7N5))]
 gb|ACO95669.1|  matrix protein 1 [Influenza A virus (A/shorebird/Delaware Bay/513/2006(H7N3))]
 gb|ACO95680.1|  matrix protein 1 [Influenza A virus (A/shorebird/Delaware Bay/555/2006(H7N3))]
 gb|ACO95691.1|  matrix protein 1 [Influenza A virus (A/mallard/Alberta/243/2006(H7N3))]
 gb|ACO95702.1|  matrix protein 1 [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/124/2007(H7N3))]
 gb|ACO95713.1|  matrix protein 1 [Influenza A virus (A/mallard/New Zealand/479-8/2005(H6N2))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>sp|Q0A2D5.1|M1_I83A6  RecName: Full=Matrix protein 1; Short=M1
 gb|ABI85146.1|  matrix protein 1 [Influenza A virus (A/chicken/Pennsylvania/1370/1983(H5N2))]
 gb|ACL79912.1|  matrix protein 1 [Influenza A virus (A/chicken/VA/40018/1984(H5N2))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLE LMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMVHAMRTIGTHPSSSAGL+DDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVHAMRTIGTHPSSSAGLRDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAL31416.1|  matrix protein [Influenza A virus (A/Goose/Hong Kong/ww491/2000(H5N1))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDP NMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPTNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+QTRQMV AMRTIGTHPSSSAGLKD+LLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQTRQMVQAMRTIGTHPSSSAGLKDNLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABS52596.1|  matrix protein M1 [Influenza A virus (A/shorebird/Delaware/168/06(H16N3))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/252 (96%), Positives = 246/252 (97%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVAGQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ACD88638.1|  matrix protein 1 [Influenza A virus (A/duck/NY/13822/1995(H3N8))]
Length=252

 Score =  511 bits (1315),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 246/252 (97%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTD EALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDFEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABS89333.1|  matrix protein 1 [Influenza A virus (A/chicken/Italy/2335/2000(H7N1))]
Length=252

 Score =  510 bits (1314),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVT E AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTAEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|AAV30831.1|  matrix protein [Influenza A virus (A/swine/Fujian/1/2003(H5N1))]
Length=252

 Score =  510 bits (1314),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSIIPSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMD+AVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMAT TNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATITNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVANQ RQMV AMRTIGTHP+SSAGL+DDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVANQARQMVQAMRTIGTHPNSSAGLRDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABS89344.1|  matrix protein 1 [Influenza A virus (A/turkey/Italy/1084/2000(H7N1))]
Length=252

 Score =  510 bits (1314),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY+KLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQA EAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQATEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


>gb|ABQ84486.1|  matrix protein [Influenza A virus (A/duck/Hong Kong/819/1980(H5N3))]
Length=252

 Score =  510 bits (1314),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 247/252 (98%), Gaps = 0/252 (0%)

Query  1    MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60
            MSLLTEVETYVLSI+PSGPLKAEIAQRLE VFAGKNTDLEALMEWLKTRPILSPLTKGIL
Sbjct  1    MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL  60

Query  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYS  120
            GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMD+AVKLYKKLKREITFHGAKEV+LSYS
Sbjct  61   GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKKLKREITFHGAKEVALSYS  120

Query  121  TGALASCMGLIYNRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMV  180
            TGALASCMGLIYNRMGTVTTE AFGLVCATCEQIADSQHRSHRQM TTTNPLIRHENRMV
Sbjct  121  TGALASCMGLIYNRMGTVTTEGAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV  180

Query  181  LASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAY  240
            LASTTAKAMEQMAGSSEQAAEAMEVA+Q RQMV AMRTIGTHPSSSAGLKDDLLENLQAY
Sbjct  181  LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY  240

Query  241  QKRMGVQMQRFK  252
            QKRMGVQMQRFK
Sbjct  241  QKRMGVQMQRFK  252


MP2 Protein Structural Homolgy Model

MP2 Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 MP2, residues 23-60, 82% sequence identity to pdp template 2rlf

MP2 Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
MP2 L3P 227831764_A/California/05/2 1
MP2 Y52H 229609551_A/Stockholm/28/20 1
MP2 T65M 229536073_A/Texas/07/2009 1
MP2 S82N 237511788_A/Mexico/4108/200 1

MP2 Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of MP2 Protein, 64 sequences

gi|229892724_A/Canada-NS/RV153      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229368682_A/Denmark/513/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229299506_A/Texas/05/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227977141_A/California/07/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227977109_A/California/04/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227977121_A/California/08/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396490_A/Ohio/07/2009         MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396474_A/New_York/19/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396458_A/Texas/06/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396370_A/New_York/11/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229484037_A/Mexico/InDRE448      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229462699_A/Valencia/GP4/20      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229462687_A/Castilla-La_Man      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229535995_A/South_Carolina/      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536119_A/Michigan/02/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536047_A/Arizona/02/2009      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229783401_A/New_York/1682/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229892718_A/Mexico/InDRE411      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229892713_A/Canada-NS/RV153      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|237511785_A/Mexico/4603/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536073_A/Texas/07/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|237511788_A/Mexico/4108/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|228481040_A/Auckland/2/2009      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396384_A/New_York/18/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396430_A/New_York/10/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229484040_A/Canada-ON/RV152      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229462711_A/Pais_Vasco/GP20      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229535814_A/Texas/09/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229535795_A/New_York/22/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536086_A/Indiana/09/2009      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536020_A/Arizona/01/2009      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229783380_A/New_York/1669/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229892715_A/Canada-ON/RV152      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229892721_A/Canada-AB/RV153      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|237511761_A/Mexico/4115/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|237624333_A/swine/Alberta/O      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|237511767_A/Mexico/4604/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229892727_A/Canada-ON/RV152      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229783371_A/Korea/01/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229598892_A/Texas/15/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229535832_A/California/14/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536036_A/Minnesota/02/20      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229535982_A/Texas/08/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229462723_A/Castilla-La_Man      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229484034_A/Canada-NS/RV153      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396360_A/New_York/06/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396446_A/New_York/15/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|228481037_A/Auckland/3/2009      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229536062_A/New_York/20/200      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229396497_A/Ohio/07/2009         MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227977153_A/California/08/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227831781_A/California/06/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227977165_A/California/07/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227831804_A/California/09/2      MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229299526_A/Texas/04/2009        MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|227831795_A/Texas/05/2009        --LLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 48
gi|237511779_A/Mexico/4486/200      ---LTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 47
gi|227977102_A/California/10/2      ---LTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 47
gi|237511782_A/Mexico/4482/200      ----TEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 46
gi|227809837_A/California/04/2      ----TEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 46
gi|227831822_A/Texas/04/2009        ----TEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 46
gi|227831829_A/Texas/04/2009        ----TEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 46
gi|227831764_A/California/05/2      MSPLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 50
gi|229609551_A/Stockholm/28/20      --------TPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKC 42
                                            ******************************************

gi|229892724_A/Canada-NS/RV153      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229368682_A/Denmark/513/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIE-- 95
gi|229299506_A/Texas/05/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227977141_A/California/07/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227977109_A/California/04/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227977121_A/California/08/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396490_A/Ohio/07/2009         IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396474_A/New_York/19/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396458_A/Texas/06/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396370_A/New_York/11/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229484037_A/Mexico/InDRE448      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229462699_A/Valencia/GP4/20      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229462687_A/Castilla-La_Man      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229535995_A/South_Carolina/      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536119_A/Michigan/02/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536047_A/Arizona/02/2009      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229783401_A/New_York/1682/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229892718_A/Mexico/InDRE411      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229892713_A/Canada-NS/RV153      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|237511785_A/Mexico/4603/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536073_A/Texas/07/2009        IYRRFKYGLKRGPSMEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|237511788_A/Mexico/4108/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQNAVDVDDGHFVNIELE 97
gi|228481040_A/Auckland/2/2009      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396384_A/New_York/18/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396430_A/New_York/10/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229484040_A/Canada-ON/RV152      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229462711_A/Pais_Vasco/GP20      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229535814_A/Texas/09/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229535795_A/New_York/22/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536086_A/Indiana/09/2009      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536020_A/Arizona/01/2009      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229783380_A/New_York/1669/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229892715_A/Canada-ON/RV152      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229892721_A/Canada-AB/RV153      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|237511761_A/Mexico/4115/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|237624333_A/swine/Alberta/O      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|237511767_A/Mexico/4604/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229892727_A/Canada-ON/RV152      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229783371_A/Korea/01/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229598892_A/Texas/15/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229535832_A/California/14/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536036_A/Minnesota/02/20      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229535982_A/Texas/08/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229462723_A/Castilla-La_Man      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229484034_A/Canada-NS/RV153      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396360_A/New_York/06/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396446_A/New_York/15/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|228481037_A/Auckland/3/2009      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229536062_A/New_York/20/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229396497_A/Ohio/07/2009         IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227977153_A/California/08/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227831781_A/California/06/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227977165_A/California/07/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227831804_A/California/09/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229299526_A/Texas/04/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|227831795_A/Texas/05/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 95
gi|237511779_A/Mexico/4486/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 94
gi|227977102_A/California/10/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 94
gi|237511782_A/Mexico/4482/200      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 93
gi|227809837_A/California/04/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 93
gi|227831822_A/Texas/04/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 93
gi|227831829_A/Texas/04/2009        IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 93
gi|227831764_A/California/05/2      IYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 97
gi|229609551_A/Stockholm/28/20      IHRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE 89
                                    *:************ ****************.*************  

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools