User:Michael Strong/H1N1/NA

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

Protein Structural Homolgy Model

NA Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 NA, residues 83-467, 89% sequence identity to pdp template 3b7e

Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
NA H36R 229892732_A/Mexico/InDRE411 1
NA E57K 229536081_A/Indiana/09/2009 1
NA V83M 229536111_A/Michigan/02/200 1
NA S95G 228017756_A/California/06/2 5
NA G96E 237624331_A/swine/Alberta/O 1
NA Y100H 237624331_A/swine/Alberta/O 1
NA V106I 228481034_A/Auckland/3/2009 30
NA I108V 228860931_A/Netherlands/602 1
NA P120S 229892684_A/Catalonia/P48/2 1
NA S123L 237624331_A/swine/Alberta/O 1
NA V241I 229535806_A/Texas/09/2009 1
NA N248D 229396353_A/New_York/12/200 30
NA N307T 228481034_A/Auckland/3/2009 1
NA S319R 229892682_A/Korea/01/2009 1
NA S334C 237624331_A/swine/Alberta/O 1

Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of NA Protein, 70 sequences

gi|229598898_A/Christchurch/2/      --------TIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 42
gi|229609553_A/Stockholm/28/20      ----------GSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 40
gi|227831797_A/Texas/05/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227831806_A/California/09/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396463_A/Texas/06/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535977_A/Texas/08/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536030_A/Minnesota/02/20      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229609559_A/Catalonia/P148/      -------------------------------------IQLGNQNQIETCN 13
gi|229892732_A/Mexico/InDRE411      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISRSIQLGNQNQIETCN 50
gi|229609561_A/Catalonia/P154/      -------------------------------------IQLGNQNQIETCN 13
gi|229299519_A/Texas/04/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396469_A/California/07/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227809834_A/California/04/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229368679_A/Denmark/513/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892684_A/Catalonia/P48/2      ----------------------------------SHSIQLGNQNQIETCN 16
gi|227831824_A/Texas/04/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977118_A/California/04/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229484044_A/Mexico/InDRE448      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229484042_A/Canada-NS/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535989_A/South_Carolina/      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536001_A/Kansas/02/2009       MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536044_A/Arizona/02/2009      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536014_A/Arizona/01/2009      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229598894_A/Texas/15/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229783403_A/New_York/1682/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229783382_A/New_York/1669/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892730_A/Canada-NS/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892738_A/Canada-NS/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511837_A/Mexico/4486/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511849_A/Mexico/4115/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511847_A/Mexico/4108/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535806_A/Texas/09/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536081_A/Indiana/09/2009      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|228481034_A/Auckland/3/2009      -------------------------IGNIISIWISHSIQLGNQNQIETCN 25
gi|229396353_A/New_York/12/200      MNPNQKIITIGSVCMTIGMANLILXIGNIISIWISHSIQLGNQNQIETCN 50
gi|228481042_A/Auckland/1/2009      ----------------------ILQIGNIISIWISHSIQLGNQNQIETCN 28
gi|229598875_A/Ohio/07/2009         MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536059_A/New_York/20/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396479_A/New_York/19/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396404_A/New_York/31/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396389_A/New_York/18/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977126_A/Ohio/07/2009         MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977174_A/New_York/20/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977158_A/Ohio/07/2009         MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536053_A/New_York/20/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536111_A/Michigan/02/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396415_A/New_York/23/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396451_A/New_York/15/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396375_A/New_York/11/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396435_A/New_York/10/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396365_A/New_York/06/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229484046_A/Canada-ON/RV152      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535792_A/New_York/22/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536125_A/New_York/13/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536098_A/Massachusetts/0      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535907_A/Massachusetts/0      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535824_A/California/14/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892736_A/Canada-ON/RV152      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892740_A/Canada-ON/RV152      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892734_A/Canada-AB/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511825_A/Mexico/4604/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511843_A/Mexico/4482/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511845_A/Mexico/4603/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892682_A/Korea/01/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|228860931_A/Netherlands/602      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|228017756_A/California/06/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237624331_A/swine/Alberta/O      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227831768_A/California/05/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536104_A/Nebraska/02/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536133_A/Colorado/03/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
                                                                         *************

gi|229598898_A/Christchurch/2/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 92
gi|229609553_A/Stockholm/28/20      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 90
gi|227831797_A/Texas/05/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227831806_A/California/09/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396463_A/Texas/06/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535977_A/Texas/08/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536030_A/Minnesota/02/20      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229609559_A/Catalonia/P148/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 63
gi|229892732_A/Mexico/InDRE411      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229609561_A/Catalonia/P154/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 63
gi|229299519_A/Texas/04/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396469_A/California/07/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227809834_A/California/04/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229368679_A/Denmark/513/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892684_A/Catalonia/P48/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 66
gi|227831824_A/Texas/04/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977118_A/California/04/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229484044_A/Mexico/InDRE448      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229484042_A/Canada-NS/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535989_A/South_Carolina/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536001_A/Kansas/02/2009       QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536044_A/Arizona/02/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536014_A/Arizona/01/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229598894_A/Texas/15/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229783403_A/New_York/1682/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229783382_A/New_York/1669/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892730_A/Canada-NS/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892738_A/Canada-NS/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511837_A/Mexico/4486/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511849_A/Mexico/4115/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511847_A/Mexico/4108/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535806_A/Texas/09/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536081_A/Indiana/09/2009      QSVITYKNNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|228481034_A/Auckland/3/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 75
gi|229396353_A/New_York/12/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWXIY 100
gi|228481042_A/Auckland/1/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 78
gi|229598875_A/Ohio/07/2009         QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536059_A/New_York/20/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396479_A/New_York/19/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396404_A/New_York/31/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396389_A/New_York/18/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977126_A/Ohio/07/2009         QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977174_A/New_York/20/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977158_A/Ohio/07/2009         QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536053_A/New_York/20/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536111_A/Michigan/02/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSMKLAGNSSLCPVSGWAIY 100
gi|229396415_A/New_York/23/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396451_A/New_York/15/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396375_A/New_York/11/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396435_A/New_York/10/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396365_A/New_York/06/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229484046_A/Canada-ON/RV152      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535792_A/New_York/22/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536125_A/New_York/13/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536098_A/Massachusetts/0      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535907_A/Massachusetts/0      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535824_A/California/14/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892736_A/Canada-ON/RV152      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892740_A/Canada-ON/RV152      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892734_A/Canada-AB/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511825_A/Mexico/4604/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511843_A/Mexico/4482/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511845_A/Mexico/4603/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892682_A/Korea/01/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|228860931_A/Netherlands/602      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|228017756_A/California/06/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
gi|237624331_A/swine/Alberta/O      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGEWAIH 100
gi|227831768_A/California/05/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
gi|229536104_A/Nebraska/02/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
gi|229536133_A/Colorado/03/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
                                    ******:*************************:***********. * *:

gi|229598898_A/Christchurch/2/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 142
gi|229609553_A/Stockholm/28/20      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 140
gi|227831797_A/Texas/05/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227831806_A/California/09/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396463_A/Texas/06/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535977_A/Texas/08/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536030_A/Minnesota/02/20      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229609559_A/Catalonia/P148/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 113
gi|229892732_A/Mexico/InDRE411      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229609561_A/Catalonia/P154/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 113
gi|229299519_A/Texas/04/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396469_A/California/07/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227809834_A/California/04/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229368679_A/Denmark/513/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892684_A/Catalonia/P48/2      SKDNSVRIGSKGDVFVIRESFISCSPLECRTFFLTQGALLNDKHSNGTIK 116
gi|227831824_A/Texas/04/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977118_A/California/04/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229484044_A/Mexico/InDRE448      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229484042_A/Canada-NS/RV153      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535989_A/South_Carolina/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536001_A/Kansas/02/2009       SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536044_A/Arizona/02/2009      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536014_A/Arizona/01/2009      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229598894_A/Texas/15/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229783403_A/New_York/1682/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229783382_A/New_York/1669/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892730_A/Canada-NS/RV153      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892738_A/Canada-NS/RV153      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511837_A/Mexico/4486/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511849_A/Mexico/4115/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511847_A/Mexico/4108/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535806_A/Texas/09/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536081_A/Indiana/09/2009      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228481034_A/Auckland/3/2009      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 125
gi|229396353_A/New_York/12/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228481042_A/Auckland/1/2009      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 128
gi|229598875_A/Ohio/07/2009         SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536059_A/New_York/20/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396479_A/New_York/19/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396404_A/New_York/31/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396389_A/New_York/18/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977126_A/Ohio/07/2009         SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977174_A/New_York/20/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977158_A/Ohio/07/2009         SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536053_A/New_York/20/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536111_A/Michigan/02/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396415_A/New_York/23/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396451_A/New_York/15/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396375_A/New_York/11/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396435_A/New_York/10/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396365_A/New_York/06/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229484046_A/Canada-ON/RV152      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535792_A/New_York/22/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536125_A/New_York/13/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536098_A/Massachusetts/0      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535907_A/Massachusetts/0      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535824_A/California/14/2      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892736_A/Canada-ON/RV152      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892740_A/Canada-ON/RV152      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892734_A/Canada-AB/RV153      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511825_A/Mexico/4604/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511843_A/Mexico/4482/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511845_A/Mexico/4603/200      SKDNSXRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892682_A/Korea/01/2009        SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228860931_A/Netherlands/602      SKDNSVRVGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228017756_A/California/06/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237624331_A/swine/Alberta/O      SKDNSVRIGSKGDVFVIREPFILCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227831768_A/California/05/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536104_A/Nebraska/02/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536133_A/Colorado/03/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
                                    ***** *:***********.** ***************************

gi|229598898_A/Christchurch/2/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 192
gi|229609553_A/Stockholm/28/20      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 190
gi|227831797_A/Texas/05/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227831806_A/California/09/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396463_A/Texas/06/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535977_A/Texas/08/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536030_A/Minnesota/02/20      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229609559_A/Catalonia/P148/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 163
gi|229892732_A/Mexico/InDRE411      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229609561_A/Catalonia/P154/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 163
gi|229299519_A/Texas/04/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396469_A/California/07/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227809834_A/California/04/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229368679_A/Denmark/513/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892684_A/Catalonia/P48/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 166
gi|227831824_A/Texas/04/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977118_A/California/04/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229484044_A/Mexico/InDRE448      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229484042_A/Canada-NS/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535989_A/South_Carolina/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536001_A/Kansas/02/2009       DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536044_A/Arizona/02/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536014_A/Arizona/01/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229598894_A/Texas/15/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229783403_A/New_York/1682/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229783382_A/New_York/1669/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892730_A/Canada-NS/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892738_A/Canada-NS/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511837_A/Mexico/4486/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511849_A/Mexico/4115/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511847_A/Mexico/4108/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535806_A/Texas/09/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536081_A/Indiana/09/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228481034_A/Auckland/3/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 175
gi|229396353_A/New_York/12/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228481042_A/Auckland/1/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 178
gi|229598875_A/Ohio/07/2009         DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536059_A/New_York/20/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396479_A/New_York/19/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396404_A/New_York/31/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396389_A/New_York/18/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977126_A/Ohio/07/2009         DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977174_A/New_York/20/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977158_A/Ohio/07/2009         DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536053_A/New_York/20/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536111_A/Michigan/02/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396415_A/New_York/23/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396451_A/New_York/15/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396375_A/New_York/11/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396435_A/New_York/10/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396365_A/New_York/06/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229484046_A/Canada-ON/RV152      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535792_A/New_York/22/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536125_A/New_York/13/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536098_A/Massachusetts/0      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535907_A/Massachusetts/0      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535824_A/California/14/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892736_A/Canada-ON/RV152      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892740_A/Canada-ON/RV152      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892734_A/Canada-AB/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511825_A/Mexico/4604/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511843_A/Mexico/4482/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511845_A/Mexico/4603/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892682_A/Korea/01/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228860931_A/Netherlands/602      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228017756_A/California/06/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237624331_A/swine/Alberta/O      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227831768_A/California/05/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536104_A/Nebraska/02/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536133_A/Colorado/03/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
                                    **************************************************

gi|229598898_A/Christchurch/2/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 242
gi|229609553_A/Stockholm/28/20      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 240
gi|227831797_A/Texas/05/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227831806_A/California/09/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229396463_A/Texas/06/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229535977_A/Texas/08/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536030_A/Minnesota/02/20      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229609559_A/Catalonia/P148/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 213
gi|229892732_A/Mexico/InDRE411      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229609561_A/Catalonia/P154/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 213
gi|229299519_A/Texas/04/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229396469_A/California/07/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227809834_A/California/04/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229368679_A/Denmark/513/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229892684_A/Catalonia/P48/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 216
gi|227831824_A/Texas/04/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227977118_A/California/04/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229484044_A/Mexico/InDRE448      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229484042_A/Canada-NS/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229535989_A/South_Carolina/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536001_A/Kansas/02/2009       GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536044_A/Arizona/02/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536014_A/Arizona/01/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229598894_A/Texas/15/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229783403_A/New_York/1682/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229783382_A/New_York/1669/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229892730_A/Canada-NS/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229892738_A/Canada-NS/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237511837_A/Mexico/4486/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237511849_A/Mexico/4115/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237511847_A/Mexico/4108/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229535806_A/Texas/09/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTIMTDGPSNGQ 250
gi|229536081_A/Indiana/09/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|228481034_A/Auckland/3/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 225
gi|229396353_A/New_York/12/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|228481042_A/Auckland/1/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 228
gi|229598875_A/Ohio/07/2009         GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536059_A/New_York/20/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396479_A/New_York/19/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396404_A/New_York/31/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396389_A/New_York/18/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|227977126_A/Ohio/07/2009         GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|227977174_A/New_York/20/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|227977158_A/Ohio/07/2009         GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536053_A/New_York/20/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536111_A/Michigan/02/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396415_A/New_York/23/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396451_A/New_York/15/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396375_A/New_York/11/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396435_A/New_York/10/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396365_A/New_York/06/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229484046_A/Canada-ON/RV152      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229535792_A/New_York/22/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536125_A/New_York/13/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536098_A/Massachusetts/0      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229535907_A/Massachusetts/0      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229535824_A/California/14/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892736_A/Canada-ON/RV152      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892740_A/Canada-ON/RV152      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892734_A/Canada-AB/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|237511825_A/Mexico/4604/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|237511843_A/Mexico/4482/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|237511845_A/Mexico/4603/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892682_A/Korea/01/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|228860931_A/Netherlands/602      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|228017756_A/California/06/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237624331_A/swine/Alberta/O      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227831768_A/California/05/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536104_A/Nebraska/02/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536133_A/Colorado/03/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
                                    ****************************************:******:**

gi|229598898_A/Christchurch/2/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 292
gi|229609553_A/Stockholm/28/20      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 290
gi|227831797_A/Texas/05/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227831806_A/California/09/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396463_A/Texas/06/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535977_A/Texas/08/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536030_A/Minnesota/02/20      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229609559_A/Catalonia/P148/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 263
gi|229892732_A/Mexico/InDRE411      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229609561_A/Catalonia/P154/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 263
gi|229299519_A/Texas/04/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396469_A/California/07/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227809834_A/California/04/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229368679_A/Denmark/513/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892684_A/Catalonia/P48/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 266
gi|227831824_A/Texas/04/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977118_A/California/04/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229484044_A/Mexico/InDRE448      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229484042_A/Canada-NS/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535989_A/South_Carolina/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536001_A/Kansas/02/2009       ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536044_A/Arizona/02/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536014_A/Arizona/01/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229598894_A/Texas/15/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229783403_A/New_York/1682/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229783382_A/New_York/1669/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892730_A/Canada-NS/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892738_A/Canada-NS/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511837_A/Mexico/4486/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511849_A/Mexico/4115/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511847_A/Mexico/4108/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535806_A/Texas/09/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536081_A/Indiana/09/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228481034_A/Auckland/3/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 275
gi|229396353_A/New_York/12/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228481042_A/Auckland/1/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 278
gi|229598875_A/Ohio/07/2009         ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536059_A/New_York/20/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396479_A/New_York/19/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396404_A/New_York/31/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396389_A/New_York/18/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977126_A/Ohio/07/2009         ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977174_A/New_York/20/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977158_A/Ohio/07/2009         ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536053_A/New_York/20/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536111_A/Michigan/02/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396415_A/New_York/23/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396451_A/New_York/15/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396375_A/New_York/11/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396435_A/New_York/10/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396365_A/New_York/06/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229484046_A/Canada-ON/RV152      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535792_A/New_York/22/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536125_A/New_York/13/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536098_A/Massachusetts/0      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535907_A/Massachusetts/0      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535824_A/California/14/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892736_A/Canada-ON/RV152      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892740_A/Canada-ON/RV152      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892734_A/Canada-AB/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511825_A/Mexico/4604/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511843_A/Mexico/4482/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511845_A/Mexico/4603/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892682_A/Korea/01/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228860931_A/Netherlands/602      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228017756_A/California/06/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237624331_A/swine/Alberta/O      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227831768_A/California/05/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536104_A/Nebraska/02/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536133_A/Colorado/03/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
                                    **************************************************

gi|229598898_A/Christchurch/2/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 342
gi|229609553_A/Stockholm/28/20      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 340
gi|227831797_A/Texas/05/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227831806_A/California/09/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396463_A/Texas/06/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535977_A/Texas/08/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536030_A/Minnesota/02/20      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229609559_A/Catalonia/P148/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 313
gi|229892732_A/Mexico/InDRE411      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229609561_A/Catalonia/P154/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 313
gi|229299519_A/Texas/04/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396469_A/California/07/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227809834_A/California/04/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229368679_A/Denmark/513/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892684_A/Catalonia/P48/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 316
gi|227831824_A/Texas/04/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977118_A/California/04/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229484044_A/Mexico/InDRE448      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229484042_A/Canada-NS/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535989_A/South_Carolina/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536001_A/Kansas/02/2009       RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536044_A/Arizona/02/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536014_A/Arizona/01/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229598894_A/Texas/15/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229783403_A/New_York/1682/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229783382_A/New_York/1669/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892730_A/Canada-NS/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892738_A/Canada-NS/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511837_A/Mexico/4486/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511849_A/Mexico/4115/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511847_A/Mexico/4108/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535806_A/Texas/09/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536081_A/Indiana/09/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228481034_A/Auckland/3/2009      RPWVSFTQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGXKGFS 325
gi|229396353_A/New_York/12/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228481042_A/Auckland/1/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 328
gi|229598875_A/Ohio/07/2009         RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536059_A/New_York/20/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396479_A/New_York/19/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396404_A/New_York/31/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396389_A/New_York/18/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977126_A/Ohio/07/2009         RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977174_A/New_York/20/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977158_A/Ohio/07/2009         RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536053_A/New_York/20/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536111_A/Michigan/02/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396415_A/New_York/23/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396451_A/New_York/15/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396375_A/New_York/11/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396435_A/New_York/10/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396365_A/New_York/06/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229484046_A/Canada-ON/RV152      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535792_A/New_York/22/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536125_A/New_York/13/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536098_A/Massachusetts/0      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535907_A/Massachusetts/0      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535824_A/California/14/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892736_A/Canada-ON/RV152      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892740_A/Canada-ON/RV152      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892734_A/Canada-AB/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511825_A/Mexico/4604/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511843_A/Mexico/4482/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511845_A/Mexico/4603/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892682_A/Korea/01/2009        RPWVSFNQNLEYQIGYICRGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228860931_A/Netherlands/602      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228017756_A/California/06/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237624331_A/swine/Alberta/O      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGCCGPVSSNGANGVKGFS 350
gi|227831768_A/California/05/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536104_A/Nebraska/02/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536133_A/Colorado/03/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
                                    ******.*********** **************.*********** ****

gi|229598898_A/Christchurch/2/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 392
gi|229609553_A/Stockholm/28/20      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 390
gi|227831797_A/Texas/05/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227831806_A/California/09/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396463_A/Texas/06/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535977_A/Texas/08/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536030_A/Minnesota/02/20      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229609559_A/Catalonia/P148/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 363
gi|229892732_A/Mexico/InDRE411      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229609561_A/Catalonia/P154/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 363
gi|229299519_A/Texas/04/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396469_A/California/07/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227809834_A/California/04/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229368679_A/Denmark/513/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892684_A/Catalonia/P48/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 366
gi|227831824_A/Texas/04/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977118_A/California/04/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229484044_A/Mexico/InDRE448      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229484042_A/Canada-NS/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535989_A/South_Carolina/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536001_A/Kansas/02/2009       FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536044_A/Arizona/02/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536014_A/Arizona/01/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229598894_A/Texas/15/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229783403_A/New_York/1682/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229783382_A/New_York/1669/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892730_A/Canada-NS/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892738_A/Canada-NS/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511837_A/Mexico/4486/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511849_A/Mexico/4115/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511847_A/Mexico/4108/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535806_A/Texas/09/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536081_A/Indiana/09/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228481034_A/Auckland/3/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 375
gi|229396353_A/New_York/12/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228481042_A/Auckland/1/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 378
gi|229598875_A/Ohio/07/2009         FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536059_A/New_York/20/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396479_A/New_York/19/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396404_A/New_York/31/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396389_A/New_York/18/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977126_A/Ohio/07/2009         FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977174_A/New_York/20/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977158_A/Ohio/07/2009         FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536053_A/New_York/20/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536111_A/Michigan/02/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396415_A/New_York/23/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396451_A/New_York/15/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396375_A/New_York/11/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396435_A/New_York/10/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396365_A/New_York/06/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229484046_A/Canada-ON/RV152      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535792_A/New_York/22/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536125_A/New_York/13/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536098_A/Massachusetts/0      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535907_A/Massachusetts/0      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535824_A/California/14/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892736_A/Canada-ON/RV152      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892740_A/Canada-ON/RV152      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892734_A/Canada-AB/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511825_A/Mexico/4604/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511843_A/Mexico/4482/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511845_A/Mexico/4603/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892682_A/Korea/01/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228860931_A/Netherlands/602      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228017756_A/California/06/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237624331_A/swine/Alberta/O      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227831768_A/California/05/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536104_A/Nebraska/02/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536133_A/Colorado/03/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
                                    **************************************************

gi|229598898_A/Christchurch/2/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 442
gi|229609553_A/Stockholm/28/20      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 440
gi|227831797_A/Texas/05/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227831806_A/California/09/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396463_A/Texas/06/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535977_A/Texas/08/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536030_A/Minnesota/02/20      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229609559_A/Catalonia/P148/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 413
gi|229892732_A/Mexico/InDRE411      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229609561_A/Catalonia/P154/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 413
gi|229299519_A/Texas/04/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396469_A/California/07/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227809834_A/California/04/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229368679_A/Denmark/513/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892684_A/Catalonia/P48/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 416
gi|227831824_A/Texas/04/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977118_A/California/04/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229484044_A/Mexico/InDRE448      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229484042_A/Canada-NS/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535989_A/South_Carolina/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536001_A/Kansas/02/2009       GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536044_A/Arizona/02/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536014_A/Arizona/01/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229598894_A/Texas/15/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229783403_A/New_York/1682/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229783382_A/New_York/1669/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892730_A/Canada-NS/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892738_A/Canada-NS/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511837_A/Mexico/4486/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511849_A/Mexico/4115/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511847_A/Mexico/4108/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535806_A/Texas/09/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536081_A/Indiana/09/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228481034_A/Auckland/3/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 425
gi|229396353_A/New_York/12/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228481042_A/Auckland/1/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 428
gi|229598875_A/Ohio/07/2009         GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536059_A/New_York/20/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396479_A/New_York/19/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396404_A/New_York/31/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396389_A/New_York/18/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977126_A/Ohio/07/2009         GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977174_A/New_York/20/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977158_A/Ohio/07/2009         GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536053_A/New_York/20/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536111_A/Michigan/02/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396415_A/New_York/23/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396451_A/New_York/15/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396375_A/New_York/11/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396435_A/New_York/10/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396365_A/New_York/06/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229484046_A/Canada-ON/RV152      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535792_A/New_York/22/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536125_A/New_York/13/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536098_A/Massachusetts/0      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535907_A/Massachusetts/0      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535824_A/California/14/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892736_A/Canada-ON/RV152      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892740_A/Canada-ON/RV152      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892734_A/Canada-AB/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511825_A/Mexico/4604/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511843_A/Mexico/4482/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511845_A/Mexico/4603/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892682_A/Korea/01/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228860931_A/Netherlands/602      GYSGSFXQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228017756_A/California/06/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237624331_A/swine/Alberta/O      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227831768_A/California/05/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536104_A/Nebraska/02/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536133_A/Colorado/03/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
                                    ****** *******************************************

gi|229598898_A/Christchurch/2/      DTVGWSWPDGAELP----- 456
gi|229609553_A/Stockholm/28/20      DTVGWSWPDGAE------- 452
gi|227831797_A/Texas/05/2009        DTVGWSWPDGAELPFTI-- 467
gi|227831806_A/California/09/2      DTVGWSWPDGAELPFTIDK 469
gi|229396463_A/Texas/06/2009        DTVGWSWPDGAELPFTIDK 469
gi|229535977_A/Texas/08/2009        DTVGWSWPDGAELPFTIDK 469
gi|229536030_A/Minnesota/02/20      DTVGWSWPDGAELPFTIDK 469
gi|229609559_A/Catalonia/P148/      DTVGWSWPDGAELPFT--- 429
gi|229892732_A/Mexico/InDRE411      DTVGWSWPDGAELPFTIDK 469
gi|229609561_A/Catalonia/P154/      DTVGWSWPDG--------- 423
gi|229299519_A/Texas/04/2009        DTVGWSWPDGAELPFTIDK 469
gi|229396469_A/California/07/2      DTVGWSWPDGAELPFTIDK 469
gi|227809834_A/California/04/2      DTVGWSWPDGAELPFTIDK 469
gi|229368679_A/Denmark/513/200      DTVGWSWPDGAELPFTI-- 467
gi|229892684_A/Catalonia/P48/2      DTVGWSWPDGAELPF---- 431
gi|227831824_A/Texas/04/2009        DTVGWSWPDGAELPFTIDK 469
gi|227977118_A/California/04/2      DTVGWSWPDGAELPFTIDK 469
gi|229484044_A/Mexico/InDRE448      DTVGWSWPDGAELPFTIDK 469
gi|229484042_A/Canada-NS/RV153      DTVGWSWPDGAELPFTIDK 469
gi|229535989_A/South_Carolina/      DTVGWSWPDGAELPFTIDK 469
gi|229536001_A/Kansas/02/2009       DTVGWSWPDGAELPFTIDK 469
gi|229536044_A/Arizona/02/2009      DTVGWSWPDGAELPFTIDK 469
gi|229536014_A/Arizona/01/2009      DTVGWSWPDGAELPFTIDK 469
gi|229598894_A/Texas/15/2009        DTVGWSWPDGAELPFTIDK 469
gi|229783403_A/New_York/1682/2      DTVGWSWPDGAELPFTIDK 469
gi|229783382_A/New_York/1669/2      DTVGWSWPDGAELPFTIDK 469
gi|229892730_A/Canada-NS/RV153      DTVGWSWPDGAELPFTIDK 469
gi|229892738_A/Canada-NS/RV153      DTVGWSWPDGAELPFTIDK 469
gi|237511837_A/Mexico/4486/200      DTVGWSWPDGAELPFTIDK 469
gi|237511849_A/Mexico/4115/200      DTVGWSWPDGAELPFTIDK 469
gi|237511847_A/Mexico/4108/200      DTVGWSWPDGAELPFTIDK 469
gi|229535806_A/Texas/09/2009        DTVGWSWPDGAELPFTIDK 469
gi|229536081_A/Indiana/09/2009      DTVGWSWPDGAELPFTIDK 469
gi|228481034_A/Auckland/3/2009      DTVGWSWPDGAELPFTIDK 444
gi|229396353_A/New_York/12/200      DTVGWSWPDGAELPFTIDK 469
gi|228481042_A/Auckland/1/2009      DTVGWSWPDGAELPFTIDK 447
gi|229598875_A/Ohio/07/2009         DTVGWSWPDGAELPFTIDK 469
gi|229536059_A/New_York/20/200      DTVGWSWPDGAELPFTIDK 469
gi|229396479_A/New_York/19/200      DTVGWSWPDGAELPFTIDK 469
gi|229396404_A/New_York/31/200      DTVGWSWPDGAELPFTIDK 469
gi|229396389_A/New_York/18/200      DTVGWSWPDGAELPFTIDK 469
gi|227977126_A/Ohio/07/2009         DTVGWSWPDGAE------- 462
gi|227977174_A/New_York/20/200      DTVGWSWPDGAE------- 462
gi|227977158_A/Ohio/07/2009         DTVGWSWPDGAELPFTIDK 469
gi|229536053_A/New_York/20/200      DTVGWSWPDGAELPFTIDK 469
gi|229536111_A/Michigan/02/200      DTVGWSWPDGAELPFTIDK 469
gi|229396415_A/New_York/23/200      DTVGWSWPDGAELPFTIDK 469
gi|229396451_A/New_York/15/200      DTVGWSWPDGAELPFTIDK 469
gi|229396375_A/New_York/11/200      DTVGWSWPDGAELPFTIDK 469
gi|229396435_A/New_York/10/200      DTVGWSWPDGAELPFTIDK 469
gi|229396365_A/New_York/06/200      DTVGWSWPDGAELPFTIDK 469
gi|229484046_A/Canada-ON/RV152      DTVGWSWPDGAELPFTIDK 469
gi|229535792_A/New_York/22/200      DTVGWSWPDGAELPFTIDK 469
gi|229536125_A/New_York/13/200      DTVGWSWPDGAELPFTIDK 469
gi|229536098_A/Massachusetts/0      DTVGWSWPDGAELPFTIDK 469
gi|229535907_A/Massachusetts/0      DTVGWSWPDGAELPFTIDK 469
gi|229535824_A/California/14/2      DTVGWSWPDGAELPFTIDK 469
gi|229892736_A/Canada-ON/RV152      DTVGWSWPDGAELPFTIDK 469
gi|229892740_A/Canada-ON/RV152      DTVGWSWPDGAELPFTIDK 469
gi|229892734_A/Canada-AB/RV153      DTVGWSWPDGAELPFTIDK 469
gi|237511825_A/Mexico/4604/200      DTVGWSWPDGAELPFTIDK 469
gi|237511843_A/Mexico/4482/200      DTVGWSWPDGAELPFTIDK 469
gi|237511845_A/Mexico/4603/200      DTVGWSWPDGAELPFTIDK 469
gi|229892682_A/Korea/01/2009        DTVGWSWPDGAELPFTIDK 469
gi|228860931_A/Netherlands/602      DTVGWSWPDGAELPFTIDK 469
gi|228017756_A/California/06/2      DTVGWSWPDGAELPFTIDK 469
gi|237624331_A/swine/Alberta/O      DTVGWSWPDGAELPFTIDK 469
gi|227831768_A/California/05/2      DTVGWSWPDGAELPFTIDK 469
gi|229536104_A/Nebraska/02/200      DTVGWSWPDGAELPFTIDK 469
gi|229536133_A/Colorado/03/200      DTVGWSWPDGAELPFTIDK 469
                                    **********         

BLAST

>gb|ACO25038.1|  neuraminidase [Influenza A virus (A/swine/England/WVL14/1996(H1N1))]
Length=468

 Score =  916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/468 (94%), Positives = 459/468 (98%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CMTIG+A+L+LQIGN ISIWISHSIQ+GNQNQ+ETCNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMTIGIASLVLQIGNTISIWISHSIQIGNQNQLETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNT F A Q+VVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTKFVAEQTVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGT KDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTFKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYPDS +ITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPDSGDITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWTGTDNNFS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTGTDNNFSLKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>gb|ACO25102.1|  neuraminidase [Influenza A virus (A/swine/France/WVL4/1985(H1N1))]
Length=468

 Score =  907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/468 (93%), Positives = 456/468 (97%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIIT GS+CMTIG+A+LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNTW
Sbjct  1    NPNQKIITTGSICMTIGIASLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNTNF A Q+VVSVKLAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTNFVAEQAVVSVKLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGANGVKGFSFKY NGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGANGVKGFSFKYDNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>emb|CAC86314.1|  neuraminidase [Influenza A virus (A/swine/Finistere/3616/84(H1N1))]
Length=469

 Score =  907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/469 (92%), Positives = 458/469 (97%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CMTIG+A+LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMTIGIASLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+VVSVKLAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVVSVKLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGP+SSNGANGVKGFSFKY NGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPISSNGANGVKGFSFKYDNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTK+ SSR+GFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKNTSSRSGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAH02042.1|  neuraminidase [Influenza A virus (A/swine/Ratchaburi/NIAH550/2003(H1N1))]
Length=469

 Score =  907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/469 (93%), Positives = 457/469 (97%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKII IGSVCMTIG+A+LILQIGNIIS+WISHSIQ+GN+NQ ETCNQSVITYENNT
Sbjct  1    MNPNQKIIIIGSVCMTIGIASLILQIGNIISVWISHSIQIGNKNQPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+VVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSP+RTLMSC +GEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPFRTLMSCLVGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG  WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTGWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYP+S EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPNSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDNNFS+KQDI+GI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNNFSVKQDIIGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>emb|CAC86315.1|  neuraminidase [Influenza A virus (A/swine/Belgium/1/83(H1N1))]
Length=469

 Score =  906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/469 (92%), Positives = 456/469 (97%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMIIGIASLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+VVSVKLAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVVSVKLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+ KSVE+NAPNYHYEECSCYPDS E+TCVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVAKSVELNAPNYHYEECSCYPDSGEVTCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGANGVKGFSFKY NGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGANGVKGFSFKYDNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>emb|CAC95054.1|  neuraminidase [Influenza A virus (A/turkey/France/87075/87(H1N1))]
Length=469

 Score =  904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/469 (92%), Positives = 457/469 (97%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQK+ITIGS+CMTIG+A+L+LQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNT
Sbjct  1    MNPNQKVITIGSICMTIGIASLMLQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+VVSVKLAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVVSVKLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GEVPSPYNS+FESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEVPSPYNSKFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE++APNYHYEECSCYPDS EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELDAPNYHYEECSCYPDSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGD+PRPND TGSCGPVSS GANGVKGFSFKY NGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDSPRPNDGTGSCGPVSSKGANGVKGFSFKYNNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAH02072.1|  neuraminidase [Influenza A virus (A/swine/Chonburi/NIAH589/2005(H1N1))]
 dbj|BAH02082.1|  neuraminidase [Influenza A virus (A/swine/Chachoengsao/NIAH587/2005(H1N1))]
Length=469

 Score =  903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/469 (92%), Positives = 452/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGSVC+TIG+ANLILQIGNIISIWISH  Q+GNQNQ E CNQ VITYENNT
Sbjct  1    MNPNQKIITIGSVCVTIGLANLILQIGNIISIWISHPTQIGNQNQTEACNQRVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF A Q+VVS+KLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNINFVAKQAVVSMKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS  ECR FFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSNFECRNFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC NGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACTNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGKIVKSVE+NAPNYHYEECSCYP+S EITCVCRDNWHGSN
Sbjct  241  LMTDGPSNGQASYKIFKIEKGKIVKSVELNAPNYHYEECSCYPESGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDNNFS+KQDI+GI +WSGYSGSFVQHPELTG+DC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNNFSVKQDIIGITDWSGYSGSFVQHPELTGMDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABD78107.1|  neuraminidase [Influenza A virus (A/Swine/Spain/50047/2003(H1N1))]
Length=469

 Score =  901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/469 (92%), Positives = 453/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CMT G+ +LILQIGN+ISIW SHSIQ+GNQNQ E CNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMTTGIVSLILQIGNLISIWASHSIQIGNQNQPEICNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNI+NTNF A Q VVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFV+REP
Sbjct  61   WVNQTYVNINNTNFVAEQKVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVMREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYP+S EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPESGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPV SNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVFSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD+NFS+KQDI+G+ +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTRTDDNFSVKQDIIGMTDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTV WSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVSWSWPDGAELPFTIDK  469


>gb|ACQ42235.1|  neuraminidase [Influenza A virus (A/Auckland/3/2009(H1N1))]
Length=444

 Score =  900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/444 (99%), Positives = 442/444 (99%), Gaps = 0/444 (0%)

Query  26   IGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKL  85
            IGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKL
Sbjct  1    IGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKL  60

Query  86   AGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHS  145
            AGNSSLCPVSGWAIYSKDNS+RIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHS
Sbjct  61   AGNSSLCPVSGWAIYSKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHS  120

Query  146  NGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAV  205
            NGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAV
Sbjct  121  NGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAV  180

Query  206  LKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVK  265
            LKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPS+GQASYKIFRIEKGKIVK
Sbjct  181  LKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQASYKIFRIEKGKIVK  240

Query  266  SVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDN  325
            SVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSF QNLEYQIGYICSGIFGDN
Sbjct  241  SVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFTQNLEYQIGYICSGIFGDN  300

Query  326  PRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDN  385
            PRPNDKTGSCGPVSSNGANG KGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDN
Sbjct  301  PRPNDKTGSCGPVSSNGANGXKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDN  360

Query  386  NFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISF  445
            NFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISF
Sbjct  361  NFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISF  420

Query  446  CGVNSDTVGWSWPDGAELPFTIDK  469
            CGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CGVNSDTVGWSWPDGAELPFTIDK  444


>gb|ACO25080.1|  neuraminidase [Influenza A virus (A/swine/Belgium/WVL2/1983(H1N1))]
Length=468

 Score =  899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/468 (92%), Positives = 452/468 (96%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMIIGIVSLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTNFVAEQAVASVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IEKGK+ KSVE+NAPNYHYEECSCYPDS E+TCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIEKGKVAKSVELNAPNYHYEECSCYPDSGEVTCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGANGVKGFSFKY NGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGANGVKGFSFKYDNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>gb|ABY40395.1|  neuraminidase [Influenza A virus (A/swine/Chachoengsao/NIAH587/2005(H1N1))]
Length=469

 Score =  899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/469 (92%), Positives = 450/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNP QKIITIGSVC+TIG+ANLILQIGNIISIWISH  Q+GNQNQ E CNQ VITYENNT
Sbjct  1    MNPTQKIITIGSVCVTIGLANLILQIGNIISIWISHPTQIGNQNQTEACNQRVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF A Q+VVS+KLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNINFVAKQAVVSMKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS  ECR FFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSNFECRNFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC NGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACTNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGKIVKSVE+NAPNYHYEECSCYP+S EITCVCRDNWHGSN
Sbjct  241  LMTDGPSNGQASYKIFKIEKGKIVKSVELNAPNYHYEECSCYPESGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDNNFS+KQDI+GI +WSGYSGSFVQHPELTG+DC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNNFSVKQDIIGITDWSGYSGSFVQHPELTGMDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPF IDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFNIDK  469


>gb|ACO24985.1|  neuraminidase [Influenza A virus (A/swine/Belgium/WVL1/1979(H1N1))]
Length=468

 Score =  899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/468 (92%), Positives = 452/468 (96%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CMTIG+ +LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMTIGIVSLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTNFVAEQAVASVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKY NGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYDNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>emb|CAC86317.1|  neuraminidase [Influenza A virus (A/swine/Lot/2979/82(H1N1))]
Length=469

 Score =  899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/469 (92%), Positives = 452/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMIIGIVSLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVASVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKY NGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYDNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABS49946.1|  neuraminidase [Influenza A virus (A/swine/Italy/671/1987(H1N1))]
Length=469

 Score =  897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/469 (92%), Positives = 451/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+LILQIGNIISIW+SH IQ+GNQNQ ETCNQS ITYENNT
Sbjct  1    MNPNQKIITIGSICMIIGIASLILQIGNIISIWVSHLIQIGNQNQPETCNQSAITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF   Q+VVSV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNINFVTEQAVVSVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPW+SFNQNLEYQIGYICSGIFGDNPRP D TGSC PVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWMSFNQNLEYQIGYICSGIFGDNPRPKDGTGSCSPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSRNGFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRNGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNS+TVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSETVGWSWPDGAELPFTIDK  469


>gb|ABY40394.1|  neuraminidase [Influenza A virus (A/swine/Chonburi/NIAH589/2005(H1N1))]
Length=469

 Score =  897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/469 (91%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNP QKIITIGSVC+TIG+ANLILQIGNIISIWISH  Q+GNQNQ E CNQ VITYENNT
Sbjct  1    MNPTQKIITIGSVCVTIGLANLILQIGNIISIWISHPTQIGNQNQTEACNQRVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF A Q+VVS+KLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNINFVAKQAVVSMKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS  ECR FFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSNFECRNFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC NGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACTNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGKIVKSVE+NAPNYHYEECSCYP+S EITCVCRDNWHGSN
Sbjct  241  LMTDGPSNGQASYKIFKIEKGKIVKSVELNAPNYHYEECSCYPESGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDNNFS+KQDI+GI +WSGYSGSFVQHPELTG+DC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNNFSVKQDIIGITDWSGYSGSFVQHPELTGMDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPF  DK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFNYDK  469


>gb|AAF77046.1|AF250366_1  neuraminidase [Influenza A virus (A/Swine/England/195852/92 (H1N1))]
Length=469

 Score =  897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/469 (94%), Positives = 462/469 (98%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CMTIG+A+LILQIGNIISIWISHSIQ+GNQNQ+ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMTIGIASLILQIGNIISIWISHSIQIGNQNQLETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNT F A Q+VVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTKFVAEQTVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWTGTDNNFS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTGTDNNFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACO25091.1|  neuraminidase [Influenza A virus (A/swine/France/WVL3/1984(H1N1))]
Length=468

 Score =  897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/468 (92%), Positives = 451/468 (96%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMIIGIVSLILQIGNIISIWVSHSIQIGNQNQPETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTNFVAEQAVASVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKY NGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYDNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>emb|CAC84264.1|  neuraminidase [Influenza A virus (A/duck/Hong Kong/202/77(H6N1))]
Length=469

 Score =  896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/469 (91%), Positives = 451/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIISLILQIGNIISIWVSHSIQTGNQNQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNFAA Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYVNISNTNFAAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD +FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDGSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAO62048.1|  neuraminidase [Influenza A virus (A/duck/Miyagil/9/77(H1N1))]
Length=469

 Score =  894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 452/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLILQIGNIISIWVSHSIQTGNQNQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTNFAA Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYINISNTNFAAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMVWDPNGWTETDSSFSMKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACO24996.1|  neuraminidase [Influenza A virus (A/swine/England/WVL10/1993(H1N1))]
 gb|ACO25135.1|  neuraminidase [Influenza A virus (A/swine/England/WVL7/1992(H1N1))]
Length=468

 Score =  894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/468 (94%), Positives = 461/468 (98%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CMTIG+A+LILQIGNIISIWISHSIQ+GNQNQ+ETCNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMTIGIASLILQIGNIISIWISHSIQIGNQNQLETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNT F A Q+VVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTKFVAEQTVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWTGTDNNFS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTGTDNNFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>dbj|BAF03628.1|  neuraminidase [Influenza A virus (A/duck/Miyagi/66/77(H1N1))]
Length=469

 Score =  894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 452/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSLCMVVGIISLILQIGNIISIWVSHSIQTGNQNQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTNFAA Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYINISNTNFAAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMVWDPNGWTETDSSFSMKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABV29593.1|  neuraminidase [Influenza A virus (A/swine/Italy/670/1987(H1N1))]
Length=469

 Score =  894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/469 (91%), Positives = 450/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+LILQIGNIISIW+SH IQ+GNQNQ ETCNQS ITYENN 
Sbjct  1    MNPNQKIITIGSICMIIGIASLILQIGNIISIWVSHLIQIGNQNQPETCNQSAITYENNI  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF   Q+VVSV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNINFVTEQAVVSVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPW+SFNQNLEYQIGYICSGIFGDNPRP D TGSC PVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWMSFNQNLEYQIGYICSGIFGDNPRPKDGTGSCSPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNS+TVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSETVGWSWPDGAELPFTIDK  469


>emb|CAC95057.1|  neuraminidase [Influenza A virus (A/African starling/England/983/79(H7N1))]
Length=469

 Score =  893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLILQIGNIISIWVSHSIQTGNQNQPETCNQSTITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNNNFLAEQAVSSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDT+KSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTVKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB20211.1|  neuraminidase [Influenza A virus (A/duck/Nanchang/1904/1992(H7N1))]
Length=469

 Score =  893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +L+LQIGNIISIW+SHSIQ GNQNQ E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLMLQIGNIISIWVSHSIQTGNQNQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V SV LAGNSSLCPVSGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVASVTLAGNSSLCPVSGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB20297.1|  neuraminidase [Influenza A virus (A/chicken/Hong Kong/17/1977(H6N1))]
Length=469

 Score =  893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/469 (90%), Positives = 451/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ  TCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLILQIGNIISIWVSHSIQTGNQNQPGTCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNFAA Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYVNISNTNFAAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMVWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABC73060.1|  neuraminidase [Influenza A virus (A/chicken/Hebei/718/2001(H5N1))]
Length=469

 Score =  892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLILQIGNIISIWVSHSIQTGNQNQPETCNQSTITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNNNFLAEQAVSSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECR FFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRIFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDT+KSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTVKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD+NFS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSNFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAH03374.1|  neuraminidase [Influenza A virus (A/duck/Mongolia/867/2002(H7N1))]
Length=469

 Score =  892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 450/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+L+LQIGNIISIW+SHSIQ GNQ Q+E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIASLMLQIGNIISIWVSHSIQTGNQYQLEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            W+NQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WINQTYVNISNTNFLAEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACO25146.1|  neuraminidase [Influenza A virus (A/swine/France/WVL8/1992(H1N1))]
Length=468

 Score =  892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/468 (91%), Positives = 450/468 (96%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CM IG+A+LILQIGNIISIW+SHSIQ+GNQNQ ET NQS+ITYENNTW
Sbjct  1    NPNQKIITIGSICMMIGIASLILQIGNIISIWVSHSIQIGNQNQPETWNQSIITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN VRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTNFVAEQAVASVTLAGNSSLCPISGWAIYSKDNGVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GEVPS YNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEVPSSYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKY NGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYDNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>dbj|BAF03632.1|  neuraminidase [Influenza A virus (A/duck/Hong Kong/938/80(H10N1))]
Length=469

 Score =  892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 450/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +L+LQIGNIISIW+SHSIQ GNQN+ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLMLQIGNIISIWVSHSIQTGNQNRPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            W+NQTYVNISNTNF   Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WINQTYVNISNTNFLTEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>sp|P06819.1|NRAM_I73A0  RecName: Full=Neuraminidase
 gb|AAA43377.1|  neuraminidase [Influenza A virus (A/parrot/Ulster/1973(H7N1))]
Length=469

 Score =  891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLILQIGNIISIWVSHSIQTGNQNQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVAPVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRT FLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTLFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLT+GISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTVGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMVWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAG66273.1|  neuraminidase [Influenza A virus (A/duck/Miyagi/47/1977(H11N1))]
Length=469

 Score =  891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 451/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLILQIGNIISIWVSHSIQTGNQNQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTNFAA Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYINISNTNFAAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTF LTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFSLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMVWDPNGWTETDSSFSMKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAO62041.1|  neuraminidase [Influenza A virus (A/duck/Nanchang/1944/92(H7N1))]
Length=469

 Score =  891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +L+LQIGNIISIW+SHSIQ GNQNQ E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLMLQIGNIISIWVSHSIQTGNQNQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V SV LAGNSSLCPVSGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVASVTLAGNSSLCPVSGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIK+WRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKNWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAO62054.1|  neuraminidase [Influenza A virus (A/mallard/Stralsund/41-6/81(H2N1))]
Length=469

 Score =  891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 450/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ GNQNQ E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLILQIGNIISIWVSHSIQTGNQNQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNFAA Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFAAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRN+ILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNDILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPW+SFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWISFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS  SR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTGSRSGFEMVWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>emb|CAC84263.1|  neuraminidase [Influenza A virus (A/duck/Hong Kong/175/77(H6N1))]
Length=469

 Score =  890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +LILQIGNIISIW+SHSIQ  NQNQ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLILQIGNIISIWVSHSIQTENQNQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGS+GDVFVIREP
Sbjct  61   WVNQTYVNISNTNFVAEQAVASVALAGNSSLCPISGWAIYSKDNGIRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            R KS SSR+GFEM+WDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RIKSTSSRSGFEMVWDPNGWTETDSSFSMKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAF46753.1|  neuraminidase [Influenza A virus (A/duck/Hong Kong/836/1980(H3N1))]
Length=469

 Score =  890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +L+LQIGNIISIW+SHSIQ GNQN+ ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLMLQIGNIISIWVSHSIQTGNQNRPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF   Q+  SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNINFLTEQAAASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAF62079.1|  neuraminidase [Influenza A virus (A/duck/Mongolia/47/2001(H7N1))]
 dbj|BAG85134.1|  neuraminidase [Influenza A virus (A/duck/Mongolia/540/2001(H1N1))]
Length=469

 Score =  890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIASLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLAEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACO25124.1|  neuraminidase [Influenza A virus (A/swine/Spain/WVL6/1991(H1N1))]
Length=468

 Score =  890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/468 (94%), Positives = 459/468 (98%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CMTIG+A+LILQIGNIISIWISHSIQ+GNQNQ ETCNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMTIGIASLILQIGNIISIWISHSIQIGNQNQPETCNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNTNF A Q+VVSVKLAGNSSLCPVSGWAIYSKDNSVRIG KGDVFVIREPF
Sbjct  61   VNQTYVNISNTNFVAEQAVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGPKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND+ GSCGPVSSNGANGVKGFSFKYGNGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDRKGSCGPVSSNGANGVKGFSFKYGNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWTGTDNNFS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTGTDNNFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>emb|CAG27350.1|  neuraminidase [Influenza A virus (A/mallard/France/2526/2001(H7N1))]
 emb|CAG27351.1|  neuraminidase [Influenza A virus (A/mallard/France/2525/2001(H7N1))]
 emb|CAJ43127.1|  neuraminidase [Influenza A virus (A/mallard/France/2525/2001(H7N1))]
 emb|CAJ43128.1|  neuraminidase [Influenza A virus (A/mallard/France/2526/2001(H7N1))]
Length=469

 Score =  889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+VVSV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVVSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIICVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACI41081.1|  neuraminidase [Influenza A virus (A/blue winged teal/TX/43/2002(H1N1))]
 gb|ACI41092.1|  neuraminidase [Influenza A virus (A/blue winged teal/TX/27/2002(H1N1))]
Length=469

 Score =  889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGVISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAO62057.1|  neuraminidase [Influenza A virus (A/hawk/Maryland/1/77(H6N1))]
 gb|AAO62058.1|  neuraminidase [Influenza A virus (A/gull/Maryland/4/77(H6N1))]
Length=469

 Score =  889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEM+WDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTSSRSGFEMVWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACJ14481.1|  neuraminidase [Influenza A virus (A/goose/Italy/296426/2003(H1N1))]
Length=469

 Score =  889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+L+LQIGN+ISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIASLMLQIGNMISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V  V LAGNSSLCP+SGWAIYSKDNS+RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVTPVALAGNSSLCPISGWAIYSKDNSIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SEI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGV+SDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVDSDTVGWSWPDGAELPFTIDK  469


>emb|CAG27352.1|  neuraminidase [Influenza A virus (A/Pekin Duck/France/M-2060/01 
(H1N1))]
Length=469

 Score =  889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+VVSV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVVSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIICVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSPSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAT65399.1|  neuraminidase [Influenza A virus (A/mallard/Alberta/211/98(H1N1))]
Length=469

 Score =  889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAE94701.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/Vac-1/04(H5N1))]
 dbj|BAE96569.1|  neuraminidase [Influenza A virus (A/R(duck/Mongolia/54/01-duck/Mongolia/47/01)(H5N1))]
Length=469

 Score =  889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIASLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSS+CP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLAEQAVTSVTLAGNSSICPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAF49414.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/W159/2006(H6N1))]
Length=469

 Score =  889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIMSLVLQIGNIISIWVSHSIQTGSQNYPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTN  AGQ+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNLIAGQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKG+IVKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGRIVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACO25007.1|  neuraminidase [Influenza A virus (A/swine/England/WVL11/1994(H1N1))]
Length=468

 Score =  889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/468 (94%), Positives = 460/468 (98%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CMTIG+A+LILQIGNIISIWISHSIQ+GNQNQ+E CNQSVITYENNTW
Sbjct  1    NPNQKIITIGSICMTIGIASLILQIGNIISIWISHSIQIGNQNQLEACNQSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNT F A Q+VVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF
Sbjct  61   VNQTYVNISNTKFVAEQTVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGTIKDRSP+RTLMSCP+GEVPSPYNS+FESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPHRTLMSCPVGEVPSPYNSKFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWTGTDN+FS+KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTGTDNDFSVKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>gb|ABP52006.1|  neuraminidase [Influenza A virus (A/duck/Viet Nam/Ncvd1/2002(H5N1))]
Length=469

 Score =  888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKI TIGS+CM  G+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKITTIGSICMVTGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   ++V SV LAGNSSLCP+SGWA+YSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEKTVASVTLAGNSSLCPISGWAVYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSP+RTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG NWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTNWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIFRIEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFRIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA G+KGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGIKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD+NFS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSNFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAG85132.1|  neuraminidase [Influenza A virus (A/duck/Mongolia/116/2002(H1N1))]
 dbj|BAG85133.1|  neuraminidase [Influenza A virus (A/duck/Mongolia/253/2003(H1N1))]
Length=469

 Score =  888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+A+L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIASLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLAEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE++APNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELSAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAO62052.1|  neuraminidase [Influenza A virus (A/softbill/South Africa/142/92(H7N1))]
Length=469

 Score =  888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +L+LQIGNIISIW+SHSIQ  NQNQ E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVVGIISLMLQIGNIISIWVSHSIQTENQNQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V SV LAGNSSLCPVSGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTKQAVASVTLAGNSSLCPVSGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALL DKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLTDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAL31389.1|  neuraminidase [Influenza A virus (A/Goose/Hong Kong/ww26/2000(H5N1))]
Length=469

 Score =  888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   ++V SV LAGNSSLCP+SGWA+YSKDNS+RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNSIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVS NGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD++FS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAG85135.1|  neuraminidase [Influenza A virus (A/duck/Mongolia/610/2002(H1N1))]
Length=469

 Score =  888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLAEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABE12637.1|  neuraminidase [Influenza A virus (A/swine/Spain/51915/2003(H1N1))]
Length=469

 Score =  888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/469 (92%), Positives = 451/469 (96%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKII I S+CM  G+A+LILQIGNIISIW+SHSIQ+GNQNQ ETCNQSVITYENNT
Sbjct  1    MNPNQKIIIISSICMINGIASLILQIGNIISIWVSHSIQIGNQNQTETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISN NF A Q+V+SVKLAG+S LCPVSGWAIYSKDNSVRIGS+GDVFVIREP
Sbjct  61   WVNQTYVNISNNNFVAEQAVISVKLAGSSPLCPVSGWAIYSKDNSVRIGSRGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYN IITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNDIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPDS EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDSGEIICVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+ GDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVLGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWTGTDNNFS+KQDIVGI +WSGYSGSFVQHPELTGL C+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTGTDNNFSVKQDIVGITDWSGYSGSFVQHPELTGLSCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB17749.1|  neuraminidase [Influenza A virus (A/mallard duck/Alberta/323/1988(H2N1))]
Length=469

 Score =  888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN +ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQNHLETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+   V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAAAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGV+SDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVSSDTVGWSWPDGAELPFTIDK  469


>gb|AAF77042.1|AF250362_1  neuraminidase [influenza A virus (A/duck/Alberta/35/76(H1N1))]
 gb|ABB19417.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/65/1976(H1N1))]
 gb|ABB20505.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/35/1976(H1N1))]
 gb|ABB87465.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/26/1976(H3N1))]
Length=469

 Score =  888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLMLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+VVSV LAGNSSLCP+ GWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVVSVTLAGNSSLCPIGGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACE73326.1|  neuraminidase [Influenza A virus (A/northern pintail/Alaska/44204-108/2006(H3N1))]
Length=469

 Score =  888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IGM +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGMMSLVLQIGNIISIWVSHSIQTGSQNYPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGRMVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABS70441.1|  neuraminidase [Influenza A virus (A/duck/NJ/7717-70/1995(H1N1))]
Length=469

 Score =  888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+Q+  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQSHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLVAEQTVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABD35639.1|  neuraminidase [Influenza A virus (A/duck/Taiwan/WB29/99(H6N1))]
Length=469

 Score =  887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNIS TNF   Q+VVSV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISYTNFLTEQAVVSVALAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVICVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB19532.1|  neuraminidase [Influenza A virus (A/pintail duck/ALB/219/1977(H1N1))]
Length=469

 Score =  887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLMLQIGNIISIWVSHSIQTGGQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSF+QHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFIQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABO52107.1|  neuraminidase [Influenza A virus (A/environment/Ohio/1007/2005(H1N1))]
Length=469

 Score =  887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+C+ IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICIAIGVISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLVAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSQLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRN+ILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNDILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDNNFS+KQDIV I +WSGYSGSFVQHPELTG+DC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNNFSVKQDIVAITDWSGYSGSFVQHPELTGMDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABU95372.1|  neuraminidase [Influenza A virus (A/mallard/MD/307/2002(H1N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGGQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLC +SGWAIYSKDNS+RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCLISGWAIYSKDNSIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAO62056.1|  neuraminidase [Influenza A virus (A/mallard/Alberta/76/85(H6N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN    Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIVEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCPIGE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPIGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV + +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAMTDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAF47396.1|  neuraminidase [Influenza A virus (A/duck/Hong Kong/716/1979(H6N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM +G+ +L+LQIGNIISIW+SHSIQ GNQN+ ETCNQS+ITYE+NT
Sbjct  1    MNPNQKIITIGSICMVVGIVSLMLQIGNIISIWVSHSIQTGNQNRPETCNQSIITYESNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIG+SGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTSWLTIGVSGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            R KS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RIKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABU95365.1|  neuraminidase [Influenza A virus (A/green-winged teal/LA/213GW/1987(H1N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACMNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGV+SDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVSSDTVGWSWPDGAELPFTIDK  469


>emb|CAC84261.1|  neuraminidase [Influenza A virus (A/duck/Hong Kong/3461/99(H6N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ GNQ+Q + CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLILQIGNIISIWVSHSIQTGNQHQPKPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGD+FVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDIFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNI+RTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNIMRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGL+C+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSMKQDIVAITDWSGYSGSFVQHPELTGLNCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABS70308.1|  neuraminidase [Influenza A virus (A/mallard/MD/161/2002(H1N1))]
 gb|ABS70329.1|  neuraminidase [Influenza A virus (A/mallard/MD/168/2002(H1N1))]
 gb|ABS70340.1|  neuraminidase [Influenza A virus (A/mallard/MD/170/2002(H1N1))]
 18 more sequence titles
 gb|ABS70350.1|  neuraminidase [Influenza A virus (A/mallard/MD/352/2002(H1N1))]
 gb|ABS70381.1|  neuraminidase [Influenza A virus (A/mallard/MD/382/2002(H1N1))]
 gb|ABS70403.1|  neuraminidase [Influenza A virus (A/mallard/MD/403/2002(H1N1))]
 gb|ABS70414.1|  neuraminidase [Influenza A virus (A/mallard/MD/406/2002(H1N1))]
 gb|ABU95368.1|  neuraminidase [Influenza A virus (A/mallard/MD/163/2002(H1N1))]
 gb|ABU95369.1|  neuraminidase [Influenza A virus (A/mallard/MD/168/2002(H1N1))]
 gb|ABU95370.1|  neuraminidase [Influenza A virus (A/mallard/MD/170/2002(H1N1))]
 gb|ABU95375.1|  neuraminidase [Influenza A virus (A/mallard/MD/352/2002(H1N1))]
 gb|ABU95377.1|  neuraminidase [Influenza A virus (A/mallard/MD/382/2002(H1N1))]
 gb|ABU95379.1|  neuraminidase [Influenza A virus (A/mallard/MD/403/2002(H1N1))]
 gb|ABU95381.1|  neuraminidase [Influenza A virus (A/mallard/MD/350/2002(H1N1))]
 gb|ABW94126.1|  neuraminidase [Influenza A virus (A/mallard/MD/02-163/2002(H1N1))]
 gb|ABW94128.1|  neuraminidase [Influenza A virus (A/mallard/MD/02-358/2002(H1N1))]
 gb|ACD85146.1|  neuraminidase [Influenza A virus (A/mallard/Maryland/350/2002(H1N1))]
 gb|ACF25124.1|  neuraminidase [Influenza A virus (A/mallard/MD/02-375/2002(H1N1))]
 gb|ACF25135.1|  neuraminidase [Influenza A virus (A/mallard/MD/02-359/2002(H1N1))]
 gb|ACF25146.1|  neuraminidase [Influenza A virus (A/mallard/MD/02-184/2002(H1N1))]
 gb|ACF25157.1|  neuraminidase [Influenza A virus (A/mallard/MD/02-181/2002(H1N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 446/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQN  E CNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGVISLVLQIGNIISIWVSHSIQTGNQNHPEICNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF++EKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKVEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSAKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACA47771.1|  neuraminidase [Influenza A virus (A/partridge/Shantou/2886/2003(H5N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   ++V SV LAGNSSLCP+SGWA+YSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG NWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTNWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVEMNAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVEMNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND  GSCGPVS NGA G+KGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGIGSCGPVSPNGAYGIKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD+NFS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSNFSVKQDIVDITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB21775.1|  neuraminidase [Influenza A virus (A/pigeon/MN/1407/1981(H1N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 446/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACTNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB19670.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/127/1977(H1N1))]
 gb|ABB87703.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/291/1977(H4N1))]
Length=469

 Score =  887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLMLQIGNIISIWVSHSIQTGGQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+VVSV L GNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVVSVTLLGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNG+ITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGMITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB19554.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/965/1979(H1N1))]
Length=469

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB88003.1|  neuraminidase [Influenza A virus (A/mallard/ALB/5/1995(H10N1))]
Length=469

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWASHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK++KSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVIKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>sp|Q8QPK2.1|NRAM_I00A0  RecName: Full=Neuraminidase
 gb|AAL31396.1|  neuraminidase [Influenza A virus (A/Duck/Hong Kong/2986.1/2000(H5N1))]
Length=469

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   ++V SV LAGNSSLCP+SGWA+YSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVS NGA G+KGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGIKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD+NFS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSNFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB19521.1|  neuraminidase [Influenza A virus (A/mallard duck/ALB/46/1977(H1N1))]
Length=469

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQN  ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLMLQIGNIISIWVSHSIQTGNQNHPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCPIGE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPIGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGIGWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPN+HYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNHHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABG88259.1|  neuraminidase [Influenza A virus (A/mallard/Ohio/56/1999(H1N1))]
 gb|ABJ53430.1|  neuraminidase [Influenza A virus (A/mallard/Ohio/66/1999(H1N1))]
 gb|ABL67058.1|  neuraminidase [Influenza A virus (A/green-winged teal/Ohio/72/1999(H1N1))]
 gb|ABL67069.1|  neuraminidase [Influenza A virus (A/pintail/Ohio/25/1999(H1N1))]
Length=469

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+Q+  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQSHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNLIAEQTVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSF+QNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFDQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACO25060.1|  neuraminidase [Influenza A virus (A/swine/England/WVL16/1998(H1N1))]
Length=468

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/468 (93%), Positives = 457/468 (97%), Gaps = 0/468 (0%)

Query  2    NPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTW  61
            NPNQKIITIGS+CMTIG+A+LILQIGNIISIWISHSIQ+GNQNQ  TCN+SVITYENNTW
Sbjct  1    NPNQKIITIGSICMTIGIASLILQIGNIISIWISHSIQVGNQNQPGTCNKSVITYENNTW  60

Query  62   VNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPF  121
            VNQTYVNISNT F A Q+VVS+KLAGNSSLCPVSGWAIYSKDNSVRIGS+GDVFVIREPF
Sbjct  61   VNQTYVNISNTKFVAEQTVVSMKLAGNSSLCPVSGWAIYSKDNSVRIGSRGDVFVIREPF  120

Query  122  ISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSA  181
            ISCS LECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCP+GEVPSPYNSRFESVAWSA
Sbjct  121  ISCSHLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPVGEVPSPYNSRFESVAWSA  180

Query  182  SACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  241
            SACHDGI WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV
Sbjct  181  SACHDGIGWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTV  240

Query  242  MTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNR  301
            MTDGPSNGQASYKIF+IE+GK+VKSVE+NAPNYHYEECSCYPDS EITCVCRDNWHGSNR
Sbjct  241  MTDGPSNGQASYKIFKIERGKVVKSVELNAPNYHYEECSCYPDSGEITCVCRDNWHGSNR  300

Query  302  PWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  361
            PWVSFNQNLEYQIGYICSGIFGDNPRPND+TGSCGPVSSNGANGVKGFSFKYGNGVWIGR
Sbjct  301  PWVSFNQNLEYQIGYICSGIFGDNPRPNDRTGSCGPVSSNGANGVKGFSFKYGNGVWIGR  360

Query  362  TKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPC  421
            TKS SSR+GFEMIWDPNGWTGTDN+FS KQDIVGI +WSGYSGSFVQHPELTGLDC+RPC
Sbjct  361  TKSTSSRSGFEMIWDPNGWTGTDNDFSAKQDIVGITDWSGYSGSFVQHPELTGLDCMRPC  420

Query  422  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  FWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  468


>gb|ACA47782.1|  neuraminidase [Influenza A virus (A/pheasant/Shantou/3535/2003(H5N1))]
Length=469

 Score =  887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNI+SIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIVSIWVSHSIQTGNQHQAEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   ++V SV LAGNSSLCP+SGWA+YSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG NWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTNWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVEMNAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVEMNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND  GSCGPVS NGA G+KGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGIGSCGPVSPNGAYGIKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD+NFS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSNFSVKQDIVDITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAF77040.1|AF250360_1  neuraminidase [Influenza A virus (A/Duck/Ohio/194/86 (H1N1))]
 gb|ABL67124.1|  neuraminidase [Influenza A virus (A/black duck/Ohio/194/1986(H11N1))]
Length=469

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 446/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IGM +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGMISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISN N  A Q V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNINLVAEQVVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK++KSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVIKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNL+YQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLDYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABQ43792.1|  neuraminidase [Influenza A virus (A/mallard/ON/499/2005(H5N1))]
Length=469

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIISLVLQIGNIISIWVSHSIQTGSQNYPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  AGQ+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAGQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWR+NILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRDNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKG++VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGRVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACA04691.1|  neuraminidase [Influenza A virus (A/duck/Eastern China/103/2003(H1N1))]
Length=469

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLAEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE++APNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELSAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABU95358.1|  neuraminidase [Influenza A virus (A/wood duck/MD/04-623/2004(H5N1))]
Length=469

 Score =  886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIISLVLQIGNIISIWVSHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  + LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPITLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSN QASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNDQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACE73327.1|  neuraminidase [Influenza A virus (A/northern pintail/Alaska/44203-023/2006(H6N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIMSLVLQIGNIISIWVSHSIQTGSQNYPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNN+LRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNVLRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKG+IVKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGRIVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABU95364.1|  neuraminidase [Influenza A virus (A/duck/NY/15024-21/1996(H1N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+Q+  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQSHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLVAEQTVAPVILAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNN+LRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNVLRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAG01206.1|AF216722_1  neuraminidase [Influenza A virus (A/Environment/Hong Kong/437-6/99 
(H5N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   ++V SV LAGNSSLCP+SGWA+YSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDG +WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVS NGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS +SR+GFEMIWDPNGWTGTD++FS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTNSRSGFEMIWDPNGWTGTDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABR37399.1|  neuraminidase [Influenza A virus (A/chicken/Italy/1082/1999(H7N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF   Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLTEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAIADWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ACJ53831.1|  neuraminidase [Influenza A virus (A/mute swan/Aktau/1460/2006(H5N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQYQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF A Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFLAEQAVTSVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ E+ CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGP+SS+GA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPMSSSGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|AAT65408.1|  neuraminidase [Influenza A virus (A/mallard/Alberta/47/98(H4N1))]
 gb|ABB19870.1|  neuraminidase [Influenza A virus (A/mallard/ALB/47/1998(H4N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ GN+N  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIISLILQIGNIISIWVSHSIQTGNRNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPTSGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGL+C+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLNCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABU95359.1|  neuraminidase [Influenza A virus (A/mallard/MD/11/2003(H?N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G Q+  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGGQSHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP++GWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVALAGNSSLCPINGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABB87857.1|  neuraminidase [Influenza A virus (A/mallard/Alberta/34/2001(H7N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+Q+  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGIISLVLQIGNIISIWVSHSIQTGSQSHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQTVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSF+QNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFDQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABD35633.1|  neuraminidase [Influenza A virus (A/chicken/Taiwan/0824/97(H6N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/469 (90%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +LILQIGNIISIW+SHSIQ G+Q+Q ETCNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLILQIGNIISIWVSHSIQTGDQHQPETCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTNF+  Q+V SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNFSTEQAVASVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTFKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISG DNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGSDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EITCVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSGIFGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTK+ SSR+GFEMIWDPNGWT TD++FS+KQDI+ I +WSGYSGSFVQHPELTGL+C+RP
Sbjct  361  RTKNTSSRSGFEMIWDPNGWTETDSSFSVKQDIIAITDWSGYSGSFVQHPELTGLNCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>dbj|BAF76008.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/Vac-3/2007(H5N1))]
 dbj|BAG85127.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/257/2004(H6N1))]
Length=469

 Score =  886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/469 (89%), Positives = 449/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ GNQ+Q E CNQS+ITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQPEPCNQSIITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            W+NQTYVNISNTNF   QSV+S+ LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WINQTYVNISNTNFPTEQSVISMALAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            VMTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+ EI CVCRDNWHGSN
Sbjct  241  VMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDAGEIICVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVSITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGV+SDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVSSDTVGWSWPDGAELPFTIDK  469


>dbj|BAG85129.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/w206/2006(H6N1))]
 dbj|BAG85130.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/w227/2006(H6N1))]
 dbj|BAG85131.1|  neuraminidase [Influenza A virus (A/duck/Hokkaido/w229/2006(H6N1))]
Length=469

 Score =  885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/469 (89%), Positives = 448/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW+SHSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMVIGIISLVLQIGNIISIWVSHSIQTGSQNYPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTN  AGQ+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNLIAGQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKG+IVKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGRIVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSF+QHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFIQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTV WSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVDWSWPDGAELPFTIDK  469


>gb|AAU25850.1|  neuraminidase [Influenza A virus (A/swine/Saskatchewan/18789/02(H1N1))]
Length=469

 Score =  885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS+CM IG+ +L+LQIGNIISIW++HSIQ G+QN  ETCNQSVITYENNT
Sbjct  1    MNPNQKIITIGSICMAIGVISLVLQIGNIISIWVNHSIQTGSQNHPETCNQSVITYENNT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTY+NISNTN  A Q+V  V LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYINISNTNLIAEQAVAPVTLAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECR FFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRAFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLTIGISGPDNGAVAVLKYNGIITDT+KSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTIGISGPDNGAVAVLKYNGIITDTVKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD+SE+ CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDASEVMCVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYGNGVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TDN+FS+KQDIV I +WSGYSGSFVQHPELTGLDC+RP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDNSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCMRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469


>gb|ABI84474.1|  neuraminidase [Influenza A virus (A/gray teal/Australia/1/1979(H6N1))]
Length=469

 Score =  885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/469 (89%), Positives = 447/469 (95%), Gaps = 0/469 (0%)

Query  1    MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNT  60
            MNPNQKIITIGS CM IG+ +LILQIGNIISIW+SHSIQ GNQNQ ETCNQS+ITYEN T
Sbjct  1    MNPNQKIITIGSTCMVIGITSLILQIGNIISIWVSHSIQTGNQNQPETCNQSIITYENKT  60

Query  61   WVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREP  120
            WVNQTYVNISNTN    Q+V+SV LAGNSSLCP+SGWAIYSKDN +RIGSKGDVFVIREP
Sbjct  61   WVNQTYVNISNTNIVTEQTVISVALAGNSSLCPISGWAIYSKDNGIRIGSKGDVFVIREP  120

Query  121  FISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWS  180
            FISCS LECRTFFLTQGALLNDKHSNGT+KDRSPYRTLMSCP+GE PSPYNSRFESVAWS
Sbjct  121  FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWS  180

Query  181  ASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT  240
            ASACHDGI+WLT+GISGPDNGAVAVLKYNGIITDT+KSWRNNILRTQESECAC+NGSCFT
Sbjct  181  ASACHDGISWLTVGISGPDNGAVAVLKYNGIITDTVKSWRNNILRTQESECACINGSCFT  240

Query  241  VMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN  300
            +MTDGPSNGQASYKIF+IEKGK+VKSVE+NAPNYHYEECSCYPD++EI CVCRDNWHGSN
Sbjct  241  IMTDGPSNGQASYKIFKIEKGKVVKSVELNAPNYHYEECSCYPDANEIICVCRDNWHGSN  300

Query  301  RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIG  360
            RPWVSFNQNLEYQIGYICSG+FGDNPRPND TGSCGPVSSNGA GVKGFSFKYG GVWIG
Sbjct  301  RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGKGVWIG  360

Query  361  RTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRP  420
            RTKS SSR+GFEMIWDPNGWT TD++FS+KQDIV I +WSGYSGSFVQHPELTGLDCIRP
Sbjct  361  RTKSTSSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP  420

Query  421  CFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469
            CFWVELIRGRPKE+TIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
Sbjct  421  CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK  469

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools