User:Michael Strong/H1N1/NA/MSA

From Proteopedia

Jump to: navigation, search

H1N1 Swine Flu Multiple Sequence Alignment of NA Protein, 70 sequences

NA Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009, residues 83-467, 89% sequence identity to pdp template 3b7e

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
NA H36R 229892732_A/Mexico/InDRE411 1
NA E57K 229536081_A/Indiana/09/2009 1
NA V83M 229536111_A/Michigan/02/200 1
NA S95G 228017756_A/California/06/2 5
NA G96E 237624331_A/swine/Alberta/O 1
NA Y100H 237624331_A/swine/Alberta/O 1
NA V106I 228481034_A/Auckland/3/2009 30
NA I108V 228860931_A/Netherlands/602 1
NA P120S 229892684_A/Catalonia/P48/2 1
NA S123L 237624331_A/swine/Alberta/O 1
NA V241I 229535806_A/Texas/09/2009 1
NA N248D 229396353_A/New_York/12/200 30
NA N307T 228481034_A/Auckland/3/2009 1
NA S319R 229892682_A/Korea/01/2009 1
NA S334C 237624331_A/swine/Alberta/O 1

gi|229598898_A/Christchurch/2/      --------TIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 42
gi|229609553_A/Stockholm/28/20      ----------GSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 40
gi|227831797_A/Texas/05/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227831806_A/California/09/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396463_A/Texas/06/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535977_A/Texas/08/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536030_A/Minnesota/02/20      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229609559_A/Catalonia/P148/      -------------------------------------IQLGNQNQIETCN 13
gi|229892732_A/Mexico/InDRE411      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISRSIQLGNQNQIETCN 50
gi|229609561_A/Catalonia/P154/      -------------------------------------IQLGNQNQIETCN 13
gi|229299519_A/Texas/04/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396469_A/California/07/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227809834_A/California/04/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229368679_A/Denmark/513/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892684_A/Catalonia/P48/2      ----------------------------------SHSIQLGNQNQIETCN 16
gi|227831824_A/Texas/04/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977118_A/California/04/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229484044_A/Mexico/InDRE448      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229484042_A/Canada-NS/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535989_A/South_Carolina/      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536001_A/Kansas/02/2009       MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536044_A/Arizona/02/2009      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536014_A/Arizona/01/2009      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229598894_A/Texas/15/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229783403_A/New_York/1682/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229783382_A/New_York/1669/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892730_A/Canada-NS/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892738_A/Canada-NS/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511837_A/Mexico/4486/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511849_A/Mexico/4115/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511847_A/Mexico/4108/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535806_A/Texas/09/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536081_A/Indiana/09/2009      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|228481034_A/Auckland/3/2009      -------------------------IGNIISIWISHSIQLGNQNQIETCN 25
gi|229396353_A/New_York/12/200      MNPNQKIITIGSVCMTIGMANLILXIGNIISIWISHSIQLGNQNQIETCN 50
gi|228481042_A/Auckland/1/2009      ----------------------ILQIGNIISIWISHSIQLGNQNQIETCN 28
gi|229598875_A/Ohio/07/2009         MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536059_A/New_York/20/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396479_A/New_York/19/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396404_A/New_York/31/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396389_A/New_York/18/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977126_A/Ohio/07/2009         MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977174_A/New_York/20/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227977158_A/Ohio/07/2009         MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536053_A/New_York/20/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536111_A/Michigan/02/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396415_A/New_York/23/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396451_A/New_York/15/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396375_A/New_York/11/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396435_A/New_York/10/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229396365_A/New_York/06/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229484046_A/Canada-ON/RV152      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535792_A/New_York/22/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536125_A/New_York/13/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536098_A/Massachusetts/0      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535907_A/Massachusetts/0      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229535824_A/California/14/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892736_A/Canada-ON/RV152      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892740_A/Canada-ON/RV152      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892734_A/Canada-AB/RV153      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511825_A/Mexico/4604/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511843_A/Mexico/4482/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237511845_A/Mexico/4603/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229892682_A/Korea/01/2009        MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|228860931_A/Netherlands/602      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|228017756_A/California/06/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|237624331_A/swine/Alberta/O      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|227831768_A/California/05/2      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536104_A/Nebraska/02/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
gi|229536133_A/Colorado/03/200      MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCN 50
                                                                         *************

gi|229598898_A/Christchurch/2/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 92
gi|229609553_A/Stockholm/28/20      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 90
gi|227831797_A/Texas/05/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227831806_A/California/09/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396463_A/Texas/06/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535977_A/Texas/08/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536030_A/Minnesota/02/20      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229609559_A/Catalonia/P148/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 63
gi|229892732_A/Mexico/InDRE411      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229609561_A/Catalonia/P154/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 63
gi|229299519_A/Texas/04/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396469_A/California/07/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227809834_A/California/04/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229368679_A/Denmark/513/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892684_A/Catalonia/P48/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 66
gi|227831824_A/Texas/04/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977118_A/California/04/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229484044_A/Mexico/InDRE448      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229484042_A/Canada-NS/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535989_A/South_Carolina/      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536001_A/Kansas/02/2009       QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536044_A/Arizona/02/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536014_A/Arizona/01/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229598894_A/Texas/15/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229783403_A/New_York/1682/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229783382_A/New_York/1669/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892730_A/Canada-NS/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892738_A/Canada-NS/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511837_A/Mexico/4486/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511849_A/Mexico/4115/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511847_A/Mexico/4108/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535806_A/Texas/09/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536081_A/Indiana/09/2009      QSVITYKNNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|228481034_A/Auckland/3/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 75
gi|229396353_A/New_York/12/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWXIY 100
gi|228481042_A/Auckland/1/2009      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 78
gi|229598875_A/Ohio/07/2009         QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536059_A/New_York/20/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396479_A/New_York/19/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396404_A/New_York/31/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396389_A/New_York/18/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977126_A/Ohio/07/2009         QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977174_A/New_York/20/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|227977158_A/Ohio/07/2009         QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536053_A/New_York/20/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536111_A/Michigan/02/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSMKLAGNSSLCPVSGWAIY 100
gi|229396415_A/New_York/23/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396451_A/New_York/15/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396375_A/New_York/11/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396435_A/New_York/10/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229396365_A/New_York/06/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229484046_A/Canada-ON/RV152      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535792_A/New_York/22/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536125_A/New_York/13/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229536098_A/Massachusetts/0      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535907_A/Massachusetts/0      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229535824_A/California/14/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892736_A/Canada-ON/RV152      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892740_A/Canada-ON/RV152      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892734_A/Canada-AB/RV153      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511825_A/Mexico/4604/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511843_A/Mexico/4482/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|237511845_A/Mexico/4603/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|229892682_A/Korea/01/2009        QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|228860931_A/Netherlands/602      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIY 100
gi|228017756_A/California/06/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
gi|237624331_A/swine/Alberta/O      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGEWAIH 100
gi|227831768_A/California/05/2      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
gi|229536104_A/Nebraska/02/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
gi|229536133_A/Colorado/03/200      QSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVGGWAIY 100
                                    ******:*************************:***********. * *:

gi|229598898_A/Christchurch/2/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 142
gi|229609553_A/Stockholm/28/20      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 140
gi|227831797_A/Texas/05/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227831806_A/California/09/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396463_A/Texas/06/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535977_A/Texas/08/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536030_A/Minnesota/02/20      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229609559_A/Catalonia/P148/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 113
gi|229892732_A/Mexico/InDRE411      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229609561_A/Catalonia/P154/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 113
gi|229299519_A/Texas/04/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396469_A/California/07/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227809834_A/California/04/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229368679_A/Denmark/513/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892684_A/Catalonia/P48/2      SKDNSVRIGSKGDVFVIRESFISCSPLECRTFFLTQGALLNDKHSNGTIK 116
gi|227831824_A/Texas/04/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977118_A/California/04/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229484044_A/Mexico/InDRE448      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229484042_A/Canada-NS/RV153      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535989_A/South_Carolina/      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536001_A/Kansas/02/2009       SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536044_A/Arizona/02/2009      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536014_A/Arizona/01/2009      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229598894_A/Texas/15/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229783403_A/New_York/1682/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229783382_A/New_York/1669/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892730_A/Canada-NS/RV153      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892738_A/Canada-NS/RV153      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511837_A/Mexico/4486/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511849_A/Mexico/4115/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511847_A/Mexico/4108/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535806_A/Texas/09/2009        SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536081_A/Indiana/09/2009      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228481034_A/Auckland/3/2009      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 125
gi|229396353_A/New_York/12/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228481042_A/Auckland/1/2009      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 128
gi|229598875_A/Ohio/07/2009         SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536059_A/New_York/20/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396479_A/New_York/19/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396404_A/New_York/31/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396389_A/New_York/18/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977126_A/Ohio/07/2009         SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977174_A/New_York/20/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227977158_A/Ohio/07/2009         SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536053_A/New_York/20/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536111_A/Michigan/02/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396415_A/New_York/23/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396451_A/New_York/15/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396375_A/New_York/11/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396435_A/New_York/10/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229396365_A/New_York/06/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229484046_A/Canada-ON/RV152      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535792_A/New_York/22/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536125_A/New_York/13/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536098_A/Massachusetts/0      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535907_A/Massachusetts/0      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229535824_A/California/14/2      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892736_A/Canada-ON/RV152      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892740_A/Canada-ON/RV152      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892734_A/Canada-AB/RV153      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511825_A/Mexico/4604/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511843_A/Mexico/4482/200      SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237511845_A/Mexico/4603/200      SKDNSXRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229892682_A/Korea/01/2009        SKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228860931_A/Netherlands/602      SKDNSVRVGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|228017756_A/California/06/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|237624331_A/swine/Alberta/O      SKDNSVRIGSKGDVFVIREPFILCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|227831768_A/California/05/2      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536104_A/Nebraska/02/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
gi|229536133_A/Colorado/03/200      SKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIK 150
                                    ***** *:***********.** ***************************

gi|229598898_A/Christchurch/2/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 192
gi|229609553_A/Stockholm/28/20      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 190
gi|227831797_A/Texas/05/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227831806_A/California/09/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396463_A/Texas/06/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535977_A/Texas/08/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536030_A/Minnesota/02/20      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229609559_A/Catalonia/P148/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 163
gi|229892732_A/Mexico/InDRE411      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229609561_A/Catalonia/P154/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 163
gi|229299519_A/Texas/04/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396469_A/California/07/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227809834_A/California/04/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229368679_A/Denmark/513/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892684_A/Catalonia/P48/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 166
gi|227831824_A/Texas/04/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977118_A/California/04/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229484044_A/Mexico/InDRE448      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229484042_A/Canada-NS/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535989_A/South_Carolina/      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536001_A/Kansas/02/2009       DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536044_A/Arizona/02/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536014_A/Arizona/01/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229598894_A/Texas/15/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229783403_A/New_York/1682/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229783382_A/New_York/1669/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892730_A/Canada-NS/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892738_A/Canada-NS/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511837_A/Mexico/4486/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511849_A/Mexico/4115/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511847_A/Mexico/4108/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535806_A/Texas/09/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536081_A/Indiana/09/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228481034_A/Auckland/3/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 175
gi|229396353_A/New_York/12/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228481042_A/Auckland/1/2009      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 178
gi|229598875_A/Ohio/07/2009         DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536059_A/New_York/20/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396479_A/New_York/19/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396404_A/New_York/31/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396389_A/New_York/18/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977126_A/Ohio/07/2009         DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977174_A/New_York/20/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227977158_A/Ohio/07/2009         DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536053_A/New_York/20/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536111_A/Michigan/02/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396415_A/New_York/23/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396451_A/New_York/15/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396375_A/New_York/11/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396435_A/New_York/10/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229396365_A/New_York/06/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229484046_A/Canada-ON/RV152      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535792_A/New_York/22/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536125_A/New_York/13/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536098_A/Massachusetts/0      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535907_A/Massachusetts/0      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229535824_A/California/14/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892736_A/Canada-ON/RV152      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892740_A/Canada-ON/RV152      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892734_A/Canada-AB/RV153      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511825_A/Mexico/4604/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511843_A/Mexico/4482/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237511845_A/Mexico/4603/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229892682_A/Korea/01/2009        DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228860931_A/Netherlands/602      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|228017756_A/California/06/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|237624331_A/swine/Alberta/O      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|227831768_A/California/05/2      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536104_A/Nebraska/02/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
gi|229536133_A/Colorado/03/200      DRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDN 200
                                    **************************************************

gi|229598898_A/Christchurch/2/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 242
gi|229609553_A/Stockholm/28/20      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 240
gi|227831797_A/Texas/05/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227831806_A/California/09/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229396463_A/Texas/06/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229535977_A/Texas/08/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536030_A/Minnesota/02/20      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229609559_A/Catalonia/P148/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 213
gi|229892732_A/Mexico/InDRE411      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229609561_A/Catalonia/P154/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 213
gi|229299519_A/Texas/04/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229396469_A/California/07/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227809834_A/California/04/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229368679_A/Denmark/513/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229892684_A/Catalonia/P48/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 216
gi|227831824_A/Texas/04/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227977118_A/California/04/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229484044_A/Mexico/InDRE448      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229484042_A/Canada-NS/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229535989_A/South_Carolina/      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536001_A/Kansas/02/2009       GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536044_A/Arizona/02/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536014_A/Arizona/01/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229598894_A/Texas/15/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229783403_A/New_York/1682/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229783382_A/New_York/1669/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229892730_A/Canada-NS/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229892738_A/Canada-NS/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237511837_A/Mexico/4486/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237511849_A/Mexico/4115/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237511847_A/Mexico/4108/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229535806_A/Texas/09/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTIMTDGPSNGQ 250
gi|229536081_A/Indiana/09/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|228481034_A/Auckland/3/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 225
gi|229396353_A/New_York/12/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|228481042_A/Auckland/1/2009      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 228
gi|229598875_A/Ohio/07/2009         GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536059_A/New_York/20/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396479_A/New_York/19/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396404_A/New_York/31/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396389_A/New_York/18/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|227977126_A/Ohio/07/2009         GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|227977174_A/New_York/20/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|227977158_A/Ohio/07/2009         GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536053_A/New_York/20/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536111_A/Michigan/02/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396415_A/New_York/23/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396451_A/New_York/15/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396375_A/New_York/11/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396435_A/New_York/10/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229396365_A/New_York/06/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229484046_A/Canada-ON/RV152      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229535792_A/New_York/22/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536125_A/New_York/13/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229536098_A/Massachusetts/0      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229535907_A/Massachusetts/0      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229535824_A/California/14/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892736_A/Canada-ON/RV152      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892740_A/Canada-ON/RV152      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892734_A/Canada-AB/RV153      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|237511825_A/Mexico/4604/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|237511843_A/Mexico/4482/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|237511845_A/Mexico/4603/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSDGQ 250
gi|229892682_A/Korea/01/2009        GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|228860931_A/Netherlands/602      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|228017756_A/California/06/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|237624331_A/swine/Alberta/O      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|227831768_A/California/05/2      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536104_A/Nebraska/02/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
gi|229536133_A/Colorado/03/200      GAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQ 250
                                    ****************************************:******:**

gi|229598898_A/Christchurch/2/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 292
gi|229609553_A/Stockholm/28/20      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 290
gi|227831797_A/Texas/05/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227831806_A/California/09/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396463_A/Texas/06/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535977_A/Texas/08/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536030_A/Minnesota/02/20      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229609559_A/Catalonia/P148/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 263
gi|229892732_A/Mexico/InDRE411      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229609561_A/Catalonia/P154/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 263
gi|229299519_A/Texas/04/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396469_A/California/07/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227809834_A/California/04/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229368679_A/Denmark/513/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892684_A/Catalonia/P48/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 266
gi|227831824_A/Texas/04/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977118_A/California/04/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229484044_A/Mexico/InDRE448      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229484042_A/Canada-NS/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535989_A/South_Carolina/      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536001_A/Kansas/02/2009       ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536044_A/Arizona/02/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536014_A/Arizona/01/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229598894_A/Texas/15/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229783403_A/New_York/1682/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229783382_A/New_York/1669/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892730_A/Canada-NS/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892738_A/Canada-NS/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511837_A/Mexico/4486/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511849_A/Mexico/4115/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511847_A/Mexico/4108/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535806_A/Texas/09/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536081_A/Indiana/09/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228481034_A/Auckland/3/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 275
gi|229396353_A/New_York/12/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228481042_A/Auckland/1/2009      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 278
gi|229598875_A/Ohio/07/2009         ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536059_A/New_York/20/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396479_A/New_York/19/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396404_A/New_York/31/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396389_A/New_York/18/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977126_A/Ohio/07/2009         ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977174_A/New_York/20/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227977158_A/Ohio/07/2009         ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536053_A/New_York/20/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536111_A/Michigan/02/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396415_A/New_York/23/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396451_A/New_York/15/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396375_A/New_York/11/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396435_A/New_York/10/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229396365_A/New_York/06/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229484046_A/Canada-ON/RV152      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535792_A/New_York/22/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536125_A/New_York/13/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536098_A/Massachusetts/0      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535907_A/Massachusetts/0      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229535824_A/California/14/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892736_A/Canada-ON/RV152      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892740_A/Canada-ON/RV152      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892734_A/Canada-AB/RV153      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511825_A/Mexico/4604/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511843_A/Mexico/4482/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237511845_A/Mexico/4603/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229892682_A/Korea/01/2009        ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228860931_A/Netherlands/602      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|228017756_A/California/06/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|237624331_A/swine/Alberta/O      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|227831768_A/California/05/2      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536104_A/Nebraska/02/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
gi|229536133_A/Colorado/03/200      ASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSN 300
                                    **************************************************

gi|229598898_A/Christchurch/2/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 342
gi|229609553_A/Stockholm/28/20      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 340
gi|227831797_A/Texas/05/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227831806_A/California/09/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396463_A/Texas/06/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535977_A/Texas/08/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536030_A/Minnesota/02/20      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229609559_A/Catalonia/P148/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 313
gi|229892732_A/Mexico/InDRE411      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229609561_A/Catalonia/P154/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 313
gi|229299519_A/Texas/04/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396469_A/California/07/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227809834_A/California/04/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229368679_A/Denmark/513/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892684_A/Catalonia/P48/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 316
gi|227831824_A/Texas/04/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977118_A/California/04/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229484044_A/Mexico/InDRE448      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229484042_A/Canada-NS/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535989_A/South_Carolina/      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536001_A/Kansas/02/2009       RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536044_A/Arizona/02/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536014_A/Arizona/01/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229598894_A/Texas/15/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229783403_A/New_York/1682/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229783382_A/New_York/1669/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892730_A/Canada-NS/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892738_A/Canada-NS/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511837_A/Mexico/4486/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511849_A/Mexico/4115/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511847_A/Mexico/4108/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535806_A/Texas/09/2009        RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536081_A/Indiana/09/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228481034_A/Auckland/3/2009      RPWVSFTQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGXKGFS 325
gi|229396353_A/New_York/12/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228481042_A/Auckland/1/2009      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 328
gi|229598875_A/Ohio/07/2009         RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536059_A/New_York/20/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396479_A/New_York/19/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396404_A/New_York/31/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396389_A/New_York/18/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977126_A/Ohio/07/2009         RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977174_A/New_York/20/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|227977158_A/Ohio/07/2009         RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536053_A/New_York/20/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536111_A/Michigan/02/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396415_A/New_York/23/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396451_A/New_York/15/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396375_A/New_York/11/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396435_A/New_York/10/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229396365_A/New_York/06/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229484046_A/Canada-ON/RV152      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535792_A/New_York/22/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536125_A/New_York/13/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536098_A/Massachusetts/0      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535907_A/Massachusetts/0      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229535824_A/California/14/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892736_A/Canada-ON/RV152      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892740_A/Canada-ON/RV152      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892734_A/Canada-AB/RV153      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511825_A/Mexico/4604/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511843_A/Mexico/4482/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237511845_A/Mexico/4603/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229892682_A/Korea/01/2009        RPWVSFNQNLEYQIGYICRGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228860931_A/Netherlands/602      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|228017756_A/California/06/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|237624331_A/swine/Alberta/O      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGCCGPVSSNGANGVKGFS 350
gi|227831768_A/California/05/2      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536104_A/Nebraska/02/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
gi|229536133_A/Colorado/03/200      RPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFS 350
                                    ******.*********** **************.*********** ****

gi|229598898_A/Christchurch/2/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 392
gi|229609553_A/Stockholm/28/20      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 390
gi|227831797_A/Texas/05/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227831806_A/California/09/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396463_A/Texas/06/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535977_A/Texas/08/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536030_A/Minnesota/02/20      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229609559_A/Catalonia/P148/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 363
gi|229892732_A/Mexico/InDRE411      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229609561_A/Catalonia/P154/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 363
gi|229299519_A/Texas/04/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396469_A/California/07/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227809834_A/California/04/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229368679_A/Denmark/513/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892684_A/Catalonia/P48/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 366
gi|227831824_A/Texas/04/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977118_A/California/04/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229484044_A/Mexico/InDRE448      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229484042_A/Canada-NS/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535989_A/South_Carolina/      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536001_A/Kansas/02/2009       FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536044_A/Arizona/02/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536014_A/Arizona/01/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229598894_A/Texas/15/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229783403_A/New_York/1682/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229783382_A/New_York/1669/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892730_A/Canada-NS/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892738_A/Canada-NS/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511837_A/Mexico/4486/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511849_A/Mexico/4115/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511847_A/Mexico/4108/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535806_A/Texas/09/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536081_A/Indiana/09/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228481034_A/Auckland/3/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 375
gi|229396353_A/New_York/12/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228481042_A/Auckland/1/2009      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 378
gi|229598875_A/Ohio/07/2009         FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536059_A/New_York/20/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396479_A/New_York/19/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396404_A/New_York/31/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396389_A/New_York/18/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977126_A/Ohio/07/2009         FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977174_A/New_York/20/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227977158_A/Ohio/07/2009         FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536053_A/New_York/20/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536111_A/Michigan/02/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396415_A/New_York/23/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396451_A/New_York/15/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396375_A/New_York/11/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396435_A/New_York/10/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229396365_A/New_York/06/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229484046_A/Canada-ON/RV152      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535792_A/New_York/22/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536125_A/New_York/13/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536098_A/Massachusetts/0      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535907_A/Massachusetts/0      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229535824_A/California/14/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892736_A/Canada-ON/RV152      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892740_A/Canada-ON/RV152      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892734_A/Canada-AB/RV153      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511825_A/Mexico/4604/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511843_A/Mexico/4482/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237511845_A/Mexico/4603/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229892682_A/Korea/01/2009        FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228860931_A/Netherlands/602      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|228017756_A/California/06/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|237624331_A/swine/Alberta/O      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|227831768_A/California/05/2      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536104_A/Nebraska/02/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
gi|229536133_A/Colorado/03/200      FKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWS 400
                                    **************************************************

gi|229598898_A/Christchurch/2/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 442
gi|229609553_A/Stockholm/28/20      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 440
gi|227831797_A/Texas/05/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227831806_A/California/09/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396463_A/Texas/06/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535977_A/Texas/08/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536030_A/Minnesota/02/20      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229609559_A/Catalonia/P148/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 413
gi|229892732_A/Mexico/InDRE411      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229609561_A/Catalonia/P154/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 413
gi|229299519_A/Texas/04/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396469_A/California/07/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227809834_A/California/04/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229368679_A/Denmark/513/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892684_A/Catalonia/P48/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 416
gi|227831824_A/Texas/04/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977118_A/California/04/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229484044_A/Mexico/InDRE448      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229484042_A/Canada-NS/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535989_A/South_Carolina/      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536001_A/Kansas/02/2009       GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536044_A/Arizona/02/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536014_A/Arizona/01/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229598894_A/Texas/15/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229783403_A/New_York/1682/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229783382_A/New_York/1669/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892730_A/Canada-NS/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892738_A/Canada-NS/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511837_A/Mexico/4486/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511849_A/Mexico/4115/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511847_A/Mexico/4108/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535806_A/Texas/09/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536081_A/Indiana/09/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228481034_A/Auckland/3/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 425
gi|229396353_A/New_York/12/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228481042_A/Auckland/1/2009      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 428
gi|229598875_A/Ohio/07/2009         GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536059_A/New_York/20/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396479_A/New_York/19/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396404_A/New_York/31/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396389_A/New_York/18/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977126_A/Ohio/07/2009         GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977174_A/New_York/20/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227977158_A/Ohio/07/2009         GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536053_A/New_York/20/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536111_A/Michigan/02/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396415_A/New_York/23/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396451_A/New_York/15/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396375_A/New_York/11/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396435_A/New_York/10/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229396365_A/New_York/06/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229484046_A/Canada-ON/RV152      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535792_A/New_York/22/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536125_A/New_York/13/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536098_A/Massachusetts/0      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535907_A/Massachusetts/0      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229535824_A/California/14/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892736_A/Canada-ON/RV152      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892740_A/Canada-ON/RV152      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892734_A/Canada-AB/RV153      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511825_A/Mexico/4604/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511843_A/Mexico/4482/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237511845_A/Mexico/4603/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229892682_A/Korea/01/2009        GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228860931_A/Netherlands/602      GYSGSFXQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|228017756_A/California/06/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|237624331_A/swine/Alberta/O      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|227831768_A/California/05/2      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536104_A/Nebraska/02/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
gi|229536133_A/Colorado/03/200      GYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS 450
                                    ****** *******************************************

gi|229598898_A/Christchurch/2/      DTVGWSWPDGAELP----- 456
gi|229609553_A/Stockholm/28/20      DTVGWSWPDGAE------- 452
gi|227831797_A/Texas/05/2009        DTVGWSWPDGAELPFTI-- 467
gi|227831806_A/California/09/2      DTVGWSWPDGAELPFTIDK 469
gi|229396463_A/Texas/06/2009        DTVGWSWPDGAELPFTIDK 469
gi|229535977_A/Texas/08/2009        DTVGWSWPDGAELPFTIDK 469
gi|229536030_A/Minnesota/02/20      DTVGWSWPDGAELPFTIDK 469
gi|229609559_A/Catalonia/P148/      DTVGWSWPDGAELPFT--- 429
gi|229892732_A/Mexico/InDRE411      DTVGWSWPDGAELPFTIDK 469
gi|229609561_A/Catalonia/P154/      DTVGWSWPDG--------- 423
gi|229299519_A/Texas/04/2009        DTVGWSWPDGAELPFTIDK 469
gi|229396469_A/California/07/2      DTVGWSWPDGAELPFTIDK 469
gi|227809834_A/California/04/2      DTVGWSWPDGAELPFTIDK 469
gi|229368679_A/Denmark/513/200      DTVGWSWPDGAELPFTI-- 467
gi|229892684_A/Catalonia/P48/2      DTVGWSWPDGAELPF---- 431
gi|227831824_A/Texas/04/2009        DTVGWSWPDGAELPFTIDK 469
gi|227977118_A/California/04/2      DTVGWSWPDGAELPFTIDK 469
gi|229484044_A/Mexico/InDRE448      DTVGWSWPDGAELPFTIDK 469
gi|229484042_A/Canada-NS/RV153      DTVGWSWPDGAELPFTIDK 469
gi|229535989_A/South_Carolina/      DTVGWSWPDGAELPFTIDK 469
gi|229536001_A/Kansas/02/2009       DTVGWSWPDGAELPFTIDK 469
gi|229536044_A/Arizona/02/2009      DTVGWSWPDGAELPFTIDK 469
gi|229536014_A/Arizona/01/2009      DTVGWSWPDGAELPFTIDK 469
gi|229598894_A/Texas/15/2009        DTVGWSWPDGAELPFTIDK 469
gi|229783403_A/New_York/1682/2      DTVGWSWPDGAELPFTIDK 469
gi|229783382_A/New_York/1669/2      DTVGWSWPDGAELPFTIDK 469
gi|229892730_A/Canada-NS/RV153      DTVGWSWPDGAELPFTIDK 469
gi|229892738_A/Canada-NS/RV153      DTVGWSWPDGAELPFTIDK 469
gi|237511837_A/Mexico/4486/200      DTVGWSWPDGAELPFTIDK 469
gi|237511849_A/Mexico/4115/200      DTVGWSWPDGAELPFTIDK 469
gi|237511847_A/Mexico/4108/200      DTVGWSWPDGAELPFTIDK 469
gi|229535806_A/Texas/09/2009        DTVGWSWPDGAELPFTIDK 469
gi|229536081_A/Indiana/09/2009      DTVGWSWPDGAELPFTIDK 469
gi|228481034_A/Auckland/3/2009      DTVGWSWPDGAELPFTIDK 444
gi|229396353_A/New_York/12/200      DTVGWSWPDGAELPFTIDK 469
gi|228481042_A/Auckland/1/2009      DTVGWSWPDGAELPFTIDK 447
gi|229598875_A/Ohio/07/2009         DTVGWSWPDGAELPFTIDK 469
gi|229536059_A/New_York/20/200      DTVGWSWPDGAELPFTIDK 469
gi|229396479_A/New_York/19/200      DTVGWSWPDGAELPFTIDK 469
gi|229396404_A/New_York/31/200      DTVGWSWPDGAELPFTIDK 469
gi|229396389_A/New_York/18/200      DTVGWSWPDGAELPFTIDK 469
gi|227977126_A/Ohio/07/2009         DTVGWSWPDGAE------- 462
gi|227977174_A/New_York/20/200      DTVGWSWPDGAE------- 462
gi|227977158_A/Ohio/07/2009         DTVGWSWPDGAELPFTIDK 469
gi|229536053_A/New_York/20/200      DTVGWSWPDGAELPFTIDK 469
gi|229536111_A/Michigan/02/200      DTVGWSWPDGAELPFTIDK 469
gi|229396415_A/New_York/23/200      DTVGWSWPDGAELPFTIDK 469
gi|229396451_A/New_York/15/200      DTVGWSWPDGAELPFTIDK 469
gi|229396375_A/New_York/11/200      DTVGWSWPDGAELPFTIDK 469
gi|229396435_A/New_York/10/200      DTVGWSWPDGAELPFTIDK 469
gi|229396365_A/New_York/06/200      DTVGWSWPDGAELPFTIDK 469
gi|229484046_A/Canada-ON/RV152      DTVGWSWPDGAELPFTIDK 469
gi|229535792_A/New_York/22/200      DTVGWSWPDGAELPFTIDK 469
gi|229536125_A/New_York/13/200      DTVGWSWPDGAELPFTIDK 469
gi|229536098_A/Massachusetts/0      DTVGWSWPDGAELPFTIDK 469
gi|229535907_A/Massachusetts/0      DTVGWSWPDGAELPFTIDK 469
gi|229535824_A/California/14/2      DTVGWSWPDGAELPFTIDK 469
gi|229892736_A/Canada-ON/RV152      DTVGWSWPDGAELPFTIDK 469
gi|229892740_A/Canada-ON/RV152      DTVGWSWPDGAELPFTIDK 469
gi|229892734_A/Canada-AB/RV153      DTVGWSWPDGAELPFTIDK 469
gi|237511825_A/Mexico/4604/200      DTVGWSWPDGAELPFTIDK 469
gi|237511843_A/Mexico/4482/200      DTVGWSWPDGAELPFTIDK 469
gi|237511845_A/Mexico/4603/200      DTVGWSWPDGAELPFTIDK 469
gi|229892682_A/Korea/01/2009        DTVGWSWPDGAELPFTIDK 469
gi|228860931_A/Netherlands/602      DTVGWSWPDGAELPFTIDK 469
gi|228017756_A/California/06/2      DTVGWSWPDGAELPFTIDK 469
gi|237624331_A/swine/Alberta/O      DTVGWSWPDGAELPFTIDK 469
gi|227831768_A/California/05/2      DTVGWSWPDGAELPFTIDK 469
gi|229536104_A/Nebraska/02/200      DTVGWSWPDGAELPFTIDK 469
gi|229536133_A/Colorado/03/200      DTVGWSWPDGAELPFTIDK 469
                                    **********         

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools