User:Michael Strong/H1N1/NP

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

Protein Structural Homolgy Model

NP Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 NP, residues 28-502, 94% sequence identity to pdp template 2q06

Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
NP G22D 229598884_A/Texas/15/2009 1
NP V35A 237624329_A/swine/Alberta/O 1
NP S90N 229536012_A/Arizona/01/2009 1
NP V106I 229892748_A/Canada-ON/RV152 28
NP Q128L 227977162_A/California/07/2 1
NP L139I 229783384_A/New_York/1669/2 2
NP E198K 237624329_A/swine/Alberta/O 1
NP N208D 237624329_A/swine/Alberta/O 1
NP V223I 229536102_A/Nebraska/02/200 2
NP M228T 237624329_A/swine/Alberta/O 1
NP A257T 229396492_A/Ohio/07/2009 1
NP V349I 229536131_A/Colorado/03/200 2
NP V358M 229598873_A/Ohio/07/2009 1
NP V369I 229536077_A/Indiana/09/2009 1
NP T379I 229536102_A/Nebraska/02/200 18
NP T379V 229892752_A/Canada-NS/RV153 1
NP D381N 229396423_A/California/08/2 1
NP D381Y 237624329_A/swine/Alberta/O 1
NP T402A 237511901_A/Mexico/4516/200 1
NP S456N 229536077_A/Indiana/09/2009 1

Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of NP Protein, 67 sequences

gi|229536005_A/Kansas/03/2009       ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229783384_A/New_York/1669/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536077_A/Indiana/09/2009      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227831778_A/California/06/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227831761_A/California/05/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229462701_A/Valencia/GP4/20      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229462713_A/Pais_Vasco/GP20      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229462689_A/Castilla-La_Man      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536066_A/Texas/07/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536024_A/Minnesota/02/20      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536038_A/Arizona/02/2009      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229783405_A/New_York/1682/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511891_A/Mexico/4486/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511915_A/Mexico/4108/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227977162_A/California/07/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536012_A/Arizona/01/2009      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229598884_A/Texas/15/2009        ------MASQGTKRSYEQMETDGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229299508_A/Texas/05/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227831792_A/Texas/05/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229299528_A/Texas/04/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227831819_A/Texas/04/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227977106_A/California/04/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|227809832_A/California/04/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396465_A/Texas/06/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229462725_A/Castilla-La_Man      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535799_A/Texas/09/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535951_A/Texas/08/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535999_A/Kansas/02/2009       ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511917_A/Mexico/4115/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536057_A/New_York/20/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396355_A/New_York/12/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536051_A/New_York/20/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396481_A/New_York/19/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511911_A/Mexico/4482/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511913_A/Mexico/4603/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511895_A/Mexico/4604/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229783369_A/Korea/01/2009        ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535818_A/California/14/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535905_A/Massachusetts/0      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536096_A/Massachusetts/0      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536109_A/Michigan/02/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536123_A/New_York/13/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535786_A/New_York/22/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396367_A/New_York/06/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396437_A/New_York/10/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396377_A/New_York/11/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396453_A/New_York/15/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396393_A/New_York/18/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396417_A/New_York/23/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396406_A/New_York/31/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229598873_A/Ohio/07/2009         ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229396492_A/Ohio/07/2009         ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|237511901_A/Mexico/4516/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229892750_A/Canada-AB/RV153      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229892746_A/Canada-ON/RV152      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229892748_A/Canada-ON/RV152      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229484052_A/Canada-ON/RV152      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229892744_A/Mexico/InDRE411      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229484050_A/Mexico/InDRE448      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229396423_A/California/08/2      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229535987_A/South_Carolina/      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229536131_A/Colorado/03/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229892752_A/Canada-NS/RV153      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229536102_A/Nebraska/02/200      ------MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 44
gi|229892742_A/Canada-NS/RV153      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|229484048_A/Canada-NS/RV153      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMC 50
gi|237624329_A/swine/Alberta/O      MSDIEAMASQGTKRSYEQMETGGERQDATEIRASAGRMIGGIGRFYIQMC 50
                                          ***************.************.***************

gi|229536005_A/Kansas/03/2009       TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229783384_A/New_York/1669/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536077_A/Indiana/09/2009      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227831778_A/California/06/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227831761_A/California/05/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229462701_A/Valencia/GP4/20      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229462713_A/Pais_Vasco/GP20      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229462689_A/Castilla-La_Man      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536066_A/Texas/07/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536024_A/Minnesota/02/20      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536038_A/Arizona/02/2009      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229783405_A/New_York/1682/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511891_A/Mexico/4486/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511915_A/Mexico/4108/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227977162_A/California/07/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536012_A/Arizona/01/2009      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPNAGKDPKKTGG 94
gi|229598884_A/Texas/15/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229299508_A/Texas/05/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227831792_A/Texas/05/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229299528_A/Texas/04/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227831819_A/Texas/04/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227977106_A/California/04/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|227809832_A/California/04/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396465_A/Texas/06/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229462725_A/Castilla-La_Man      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535799_A/Texas/09/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535951_A/Texas/08/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535999_A/Kansas/02/2009       TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511917_A/Mexico/4115/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536057_A/New_York/20/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396355_A/New_York/12/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536051_A/New_York/20/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396481_A/New_York/19/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511911_A/Mexico/4482/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511913_A/Mexico/4603/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511895_A/Mexico/4604/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229783369_A/Korea/01/2009        TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535818_A/California/14/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535905_A/Massachusetts/0      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536096_A/Massachusetts/0      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536109_A/Michigan/02/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536123_A/New_York/13/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535786_A/New_York/22/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396367_A/New_York/06/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396437_A/New_York/10/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396377_A/New_York/11/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396453_A/New_York/15/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396393_A/New_York/18/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396417_A/New_York/23/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396406_A/New_York/31/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229598873_A/Ohio/07/2009         TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229396492_A/Ohio/07/2009         TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|237511901_A/Mexico/4516/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229892750_A/Canada-AB/RV153      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229892746_A/Canada-ON/RV152      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229892748_A/Canada-ON/RV152      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229484052_A/Canada-ON/RV152      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229892744_A/Mexico/InDRE411      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229484050_A/Mexico/InDRE448      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229396423_A/California/08/2      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229535987_A/South_Carolina/      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229536131_A/Colorado/03/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229892752_A/Canada-NS/RV153      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229536102_A/Nebraska/02/200      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 94
gi|229892742_A/Canada-NS/RV153      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|229484048_A/Canada-NS/RV153      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
gi|237624329_A/swine/Alberta/O      TELKLSDYDGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGG 100
                                    ***************************************.**********

gi|229536005_A/Kansas/03/2009       PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGITHIMIWHSNLN 144
gi|229783384_A/New_York/1669/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGITHIMIWHSNLN 144
gi|229536077_A/Indiana/09/2009      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227831778_A/California/06/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227831761_A/California/05/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229462701_A/Valencia/GP4/20      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229462713_A/Pais_Vasco/GP20      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229462689_A/Castilla-La_Man      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536066_A/Texas/07/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536024_A/Minnesota/02/20      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536038_A/Arizona/02/2009      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229783405_A/New_York/1682/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511891_A/Mexico/4486/200      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511915_A/Mexico/4108/200      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227977162_A/California/07/2      PIYRRVDGKWMRELILYDKXEIRRVWRLANNGEDATAGLTHIMIWHSNLN 144
gi|229536012_A/Arizona/01/2009      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229598884_A/Texas/15/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229299508_A/Texas/05/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227831792_A/Texas/05/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229299528_A/Texas/04/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227831819_A/Texas/04/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227977106_A/California/04/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|227809832_A/California/04/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396465_A/Texas/06/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229462725_A/Castilla-La_Man      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535799_A/Texas/09/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535951_A/Texas/08/2009        PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535999_A/Kansas/02/2009       PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511917_A/Mexico/4115/200      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536057_A/New_York/20/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396355_A/New_York/12/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536051_A/New_York/20/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396481_A/New_York/19/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511911_A/Mexico/4482/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511913_A/Mexico/4603/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511895_A/Mexico/4604/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229783369_A/Korea/01/2009        PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535818_A/California/14/2      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535905_A/Massachusetts/0      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536096_A/Massachusetts/0      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536109_A/Michigan/02/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536123_A/New_York/13/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535786_A/New_York/22/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396367_A/New_York/06/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396437_A/New_York/10/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396377_A/New_York/11/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396453_A/New_York/15/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396393_A/New_York/18/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396417_A/New_York/23/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396406_A/New_York/31/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229598873_A/Ohio/07/2009         PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229396492_A/Ohio/07/2009         PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|237511901_A/Mexico/4516/200      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229892750_A/Canada-AB/RV153      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229892746_A/Canada-ON/RV152      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229892748_A/Canada-ON/RV152      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229484052_A/Canada-ON/RV152      PIYRRIDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229892744_A/Mexico/InDRE411      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229484050_A/Mexico/InDRE448      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229396423_A/California/08/2      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229535987_A/South_Carolina/      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229536131_A/Colorado/03/200      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229892752_A/Canada-NS/RV153      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229536102_A/Nebraska/02/200      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 144
gi|229892742_A/Canada-NS/RV153      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|229484048_A/Canada-NS/RV153      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
gi|237624329_A/swine/Alberta/O      PIYRRVDGKWMRELILYDKEEIRRVWRQANNGEDATAGLTHIMIWHSNLN 150
                                    *****:************* ******* **********:***********

gi|229536005_A/Kansas/03/2009       DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229783384_A/New_York/1669/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536077_A/Indiana/09/2009      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227831778_A/California/06/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227831761_A/California/05/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229462701_A/Valencia/GP4/20      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229462713_A/Pais_Vasco/GP20      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229462689_A/Castilla-La_Man      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536066_A/Texas/07/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536024_A/Minnesota/02/20      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536038_A/Arizona/02/2009      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229783405_A/New_York/1682/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511891_A/Mexico/4486/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511915_A/Mexico/4108/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227977162_A/California/07/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536012_A/Arizona/01/2009      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229598884_A/Texas/15/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229299508_A/Texas/05/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227831792_A/Texas/05/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229299528_A/Texas/04/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227831819_A/Texas/04/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227977106_A/California/04/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|227809832_A/California/04/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396465_A/Texas/06/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229462725_A/Castilla-La_Man      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535799_A/Texas/09/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535951_A/Texas/08/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535999_A/Kansas/02/2009       DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511917_A/Mexico/4115/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536057_A/New_York/20/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396355_A/New_York/12/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536051_A/New_York/20/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396481_A/New_York/19/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511911_A/Mexico/4482/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511913_A/Mexico/4603/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511895_A/Mexico/4604/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229783369_A/Korea/01/2009        DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535818_A/California/14/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535905_A/Massachusetts/0      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536096_A/Massachusetts/0      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536109_A/Michigan/02/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536123_A/New_York/13/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535786_A/New_York/22/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396367_A/New_York/06/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396437_A/New_York/10/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396377_A/New_York/11/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396453_A/New_York/15/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396393_A/New_York/18/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396417_A/New_York/23/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396406_A/New_York/31/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229598873_A/Ohio/07/2009         DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229396492_A/Ohio/07/2009         DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|237511901_A/Mexico/4516/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229892750_A/Canada-AB/RV153      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229892746_A/Canada-ON/RV152      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229892748_A/Canada-ON/RV152      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229484052_A/Canada-ON/RV152      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229892744_A/Mexico/InDRE411      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229484050_A/Mexico/InDRE448      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229396423_A/California/08/2      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229535987_A/South_Carolina/      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229536131_A/Colorado/03/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229892752_A/Canada-NS/RV153      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229536102_A/Nebraska/02/200      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 194
gi|229892742_A/Canada-NS/RV153      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|229484048_A/Canada-NS/RV153      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMELI 200
gi|237624329_A/swine/Alberta/O      DATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTIAMKLI 200
                                    ***********************************************:**

gi|229536005_A/Kansas/03/2009       RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229783384_A/New_York/1669/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536077_A/Indiana/09/2009      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227831778_A/California/06/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227831761_A/California/05/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229462701_A/Valencia/GP4/20      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229462713_A/Pais_Vasco/GP20      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229462689_A/Castilla-La_Man      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536066_A/Texas/07/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536024_A/Minnesota/02/20      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536038_A/Arizona/02/2009      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229783405_A/New_York/1682/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511891_A/Mexico/4486/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511915_A/Mexico/4108/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227977162_A/California/07/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536012_A/Arizona/01/2009      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229598884_A/Texas/15/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229299508_A/Texas/05/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227831792_A/Texas/05/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229299528_A/Texas/04/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227831819_A/Texas/04/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227977106_A/California/04/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|227809832_A/California/04/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396465_A/Texas/06/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229462725_A/Castilla-La_Man      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535799_A/Texas/09/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535951_A/Texas/08/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535999_A/Kansas/02/2009       RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511917_A/Mexico/4115/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536057_A/New_York/20/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396355_A/New_York/12/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536051_A/New_York/20/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396481_A/New_York/19/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511911_A/Mexico/4482/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511913_A/Mexico/4603/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511895_A/Mexico/4604/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229783369_A/Korea/01/2009        RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535818_A/California/14/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535905_A/Massachusetts/0      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536096_A/Massachusetts/0      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536109_A/Michigan/02/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536123_A/New_York/13/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535786_A/New_York/22/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396367_A/New_York/06/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396437_A/New_York/10/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396377_A/New_York/11/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396453_A/New_York/15/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396393_A/New_York/18/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396417_A/New_York/23/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396406_A/New_York/31/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229598873_A/Ohio/07/2009         RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229396492_A/Ohio/07/2009         RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|237511901_A/Mexico/4516/200      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229892750_A/Canada-AB/RV153      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229892746_A/Canada-ON/RV152      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229892748_A/Canada-ON/RV152      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229484052_A/Canada-ON/RV152      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229892744_A/Mexico/InDRE411      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229484050_A/Mexico/InDRE448      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229396423_A/California/08/2      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229535987_A/South_Carolina/      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229536131_A/Colorado/03/200      RMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229892752_A/Canada-NS/RV153      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229536102_A/Nebraska/02/200      RMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRE 244
gi|229892742_A/Canada-NS/RV153      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|229484048_A/Canada-NS/RV153      RMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMDQVRE 250
gi|237624329_A/swine/Alberta/O      RMIKRGIDDRNFWRGENGRRTRVAYERTCNILKGKFQTAAQRAMMDQVRE 250
                                    *******:**************:**** **********************

gi|229536005_A/Kansas/03/2009       SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229783384_A/New_York/1669/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536077_A/Indiana/09/2009      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227831778_A/California/06/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227831761_A/California/05/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229462701_A/Valencia/GP4/20      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229462713_A/Pais_Vasco/GP20      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229462689_A/Castilla-La_Man      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536066_A/Texas/07/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536024_A/Minnesota/02/20      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536038_A/Arizona/02/2009      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229783405_A/New_York/1682/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511891_A/Mexico/4486/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511915_A/Mexico/4108/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227977162_A/California/07/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536012_A/Arizona/01/2009      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229598884_A/Texas/15/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229299508_A/Texas/05/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227831792_A/Texas/05/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229299528_A/Texas/04/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227831819_A/Texas/04/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227977106_A/California/04/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|227809832_A/California/04/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396465_A/Texas/06/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229462725_A/Castilla-La_Man      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535799_A/Texas/09/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535951_A/Texas/08/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535999_A/Kansas/02/2009       SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511917_A/Mexico/4115/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536057_A/New_York/20/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396355_A/New_York/12/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536051_A/New_York/20/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396481_A/New_York/19/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511911_A/Mexico/4482/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511913_A/Mexico/4603/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511895_A/Mexico/4604/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229783369_A/Korea/01/2009        SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535818_A/California/14/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535905_A/Massachusetts/0      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536096_A/Massachusetts/0      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536109_A/Michigan/02/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536123_A/New_York/13/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535786_A/New_York/22/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396367_A/New_York/06/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396437_A/New_York/10/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396377_A/New_York/11/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396453_A/New_York/15/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396393_A/New_York/18/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396417_A/New_York/23/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396406_A/New_York/31/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229598873_A/Ohio/07/2009         SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229396492_A/Ohio/07/2009         SRNPGNTEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|237511901_A/Mexico/4516/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229892750_A/Canada-AB/RV153      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229892746_A/Canada-ON/RV152      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229892748_A/Canada-ON/RV152      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229484052_A/Canada-ON/RV152      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229892744_A/Mexico/InDRE411      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229484050_A/Mexico/InDRE448      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229396423_A/California/08/2      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229535987_A/South_Carolina/      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229536131_A/Colorado/03/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229892752_A/Canada-NS/RV153      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229536102_A/Nebraska/02/200      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 294
gi|229892742_A/Canada-NS/RV153      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|229484048_A/Canada-NS/RV153      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
gi|237624329_A/swine/Alberta/O      SRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE 300
                                    ******:*******************************************

gi|229536005_A/Kansas/03/2009       GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229783384_A/New_York/1669/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536077_A/Indiana/09/2009      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227831778_A/California/06/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227831761_A/California/05/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229462701_A/Valencia/GP4/20      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229462713_A/Pais_Vasco/GP20      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229462689_A/Castilla-La_Man      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536066_A/Texas/07/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536024_A/Minnesota/02/20      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536038_A/Arizona/02/2009      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229783405_A/New_York/1682/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511891_A/Mexico/4486/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511915_A/Mexico/4108/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227977162_A/California/07/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536012_A/Arizona/01/2009      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229598884_A/Texas/15/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229299508_A/Texas/05/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227831792_A/Texas/05/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229299528_A/Texas/04/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227831819_A/Texas/04/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227977106_A/California/04/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|227809832_A/California/04/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396465_A/Texas/06/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229462725_A/Castilla-La_Man      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535799_A/Texas/09/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535951_A/Texas/08/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535999_A/Kansas/02/2009       GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511917_A/Mexico/4115/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536057_A/New_York/20/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396355_A/New_York/12/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536051_A/New_York/20/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396481_A/New_York/19/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511911_A/Mexico/4482/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511913_A/Mexico/4603/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511895_A/Mexico/4604/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229783369_A/Korea/01/2009        GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535818_A/California/14/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535905_A/Massachusetts/0      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536096_A/Massachusetts/0      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536109_A/Michigan/02/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229536123_A/New_York/13/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535786_A/New_York/22/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396367_A/New_York/06/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396437_A/New_York/10/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396377_A/New_York/11/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396453_A/New_York/15/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396393_A/New_York/18/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396417_A/New_York/23/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396406_A/New_York/31/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229598873_A/Ohio/07/2009         GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229396492_A/Ohio/07/2009         GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|237511901_A/Mexico/4516/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229892750_A/Canada-AB/RV153      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229892746_A/Canada-ON/RV152      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229892748_A/Canada-ON/RV152      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229484052_A/Canada-ON/RV152      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229892744_A/Mexico/InDRE411      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229484050_A/Mexico/InDRE448      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229396423_A/California/08/2      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229535987_A/South_Carolina/      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRIS 344
gi|229536131_A/Colorado/03/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRIS 344
gi|229892752_A/Canada-NS/RV153      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229536102_A/Nebraska/02/200      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 344
gi|229892742_A/Canada-NS/RV153      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|229484048_A/Canada-NS/RV153      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
gi|237624329_A/swine/Alberta/O      GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVS 350
                                    ************************************************:*

gi|229536005_A/Kansas/03/2009       SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229783384_A/New_York/1669/2      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229536077_A/Indiana/09/2009      SFIRGKKVIPRGKLSTRGIQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|227831778_A/California/06/2      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|227831761_A/California/05/2      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229462701_A/Valencia/GP4/20      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229462713_A/Pais_Vasco/GP20      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229462689_A/Castilla-La_Man      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229536066_A/Texas/07/2009        SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229536024_A/Minnesota/02/20      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229536038_A/Arizona/02/2009      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229783405_A/New_York/1682/2      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|237511891_A/Mexico/4486/200      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|237511915_A/Mexico/4108/200      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|227977162_A/California/07/2      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536012_A/Arizona/01/2009      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229598884_A/Texas/15/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229299508_A/Texas/05/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|227831792_A/Texas/05/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229299528_A/Texas/04/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|227831819_A/Texas/04/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|227977106_A/California/04/2      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|227809832_A/California/04/2      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396465_A/Texas/06/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229462725_A/Castilla-La_Man      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229535799_A/Texas/09/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229535951_A/Texas/08/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229535999_A/Kansas/02/2009       SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|237511917_A/Mexico/4115/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536057_A/New_York/20/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396355_A/New_York/12/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536051_A/New_York/20/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396481_A/New_York/19/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|237511911_A/Mexico/4482/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|237511913_A/Mexico/4603/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|237511895_A/Mexico/4604/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229783369_A/Korea/01/2009        SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229535818_A/California/14/2      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229535905_A/Massachusetts/0      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536096_A/Massachusetts/0      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536109_A/Michigan/02/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536123_A/New_York/13/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229535786_A/New_York/22/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396367_A/New_York/06/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396437_A/New_York/10/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396377_A/New_York/11/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396453_A/New_York/15/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396393_A/New_York/18/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396417_A/New_York/23/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396406_A/New_York/31/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229598873_A/Ohio/07/2009         SFIRGKKMIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229396492_A/Ohio/07/2009         SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|237511901_A/Mexico/4516/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229892750_A/Canada-AB/RV153      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 400
gi|229892746_A/Canada-ON/RV152      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 400
gi|229892748_A/Canada-ON/RV152      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 400
gi|229484052_A/Canada-ON/RV152      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 400
gi|229892744_A/Mexico/InDRE411      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 400
gi|229484050_A/Mexico/InDRE448      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 400
gi|229396423_A/California/08/2      SFIRGKKVIPRGKLSTRGVQIASNENVETMNSNTLELRSRYWAIRTRSGG 394
gi|229535987_A/South_Carolina/      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229536131_A/Colorado/03/200      SFIRGKKVIPRGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGG 394
gi|229892752_A/Canada-NS/RV153      SFIRGKKVIPRGKLSTRGVQIASNENVEVMDSNTLELRSRYWAIRTRSGG 400
gi|229536102_A/Nebraska/02/200      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 394
gi|229892742_A/Canada-NS/RV153      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 400
gi|229484048_A/Canada-NS/RV153      SFIRGKKVIPRGKLSTRGVQIASNENVEIMDSNTLELRSRYWAIRTRSGG 400
gi|237624329_A/swine/Alberta/O      SFIRGKKVIPRGKLSTRGVQIASNENVEIMYSNTLELRSRYWAIRTRSGG 400
                                    *******:**********:********* * *******************

gi|229536005_A/Kansas/03/2009       NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229783384_A/New_York/1669/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536077_A/Indiana/09/2009      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227831778_A/California/06/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227831761_A/California/05/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229462701_A/Valencia/GP4/20      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229462713_A/Pais_Vasco/GP20      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229462689_A/Castilla-La_Man      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536066_A/Texas/07/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536024_A/Minnesota/02/20      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536038_A/Arizona/02/2009      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229783405_A/New_York/1682/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511891_A/Mexico/4486/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511915_A/Mexico/4108/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227977162_A/California/07/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536012_A/Arizona/01/2009      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229598884_A/Texas/15/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229299508_A/Texas/05/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227831792_A/Texas/05/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229299528_A/Texas/04/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227831819_A/Texas/04/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227977106_A/California/04/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|227809832_A/California/04/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396465_A/Texas/06/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229462725_A/Castilla-La_Man      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535799_A/Texas/09/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535951_A/Texas/08/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535999_A/Kansas/02/2009       NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511917_A/Mexico/4115/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536057_A/New_York/20/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396355_A/New_York/12/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536051_A/New_York/20/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396481_A/New_York/19/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511911_A/Mexico/4482/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511913_A/Mexico/4603/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511895_A/Mexico/4604/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229783369_A/Korea/01/2009        NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535818_A/California/14/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535905_A/Massachusetts/0      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536096_A/Massachusetts/0      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536109_A/Michigan/02/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536123_A/New_York/13/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535786_A/New_York/22/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396367_A/New_York/06/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396437_A/New_York/10/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396377_A/New_York/11/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396453_A/New_York/15/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396393_A/New_York/18/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396417_A/New_York/23/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396406_A/New_York/31/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229598873_A/Ohio/07/2009         NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229396492_A/Ohio/07/2009         NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|237511901_A/Mexico/4516/200      NANQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229892750_A/Canada-AB/RV153      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229892746_A/Canada-ON/RV152      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229892748_A/Canada-ON/RV152      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229484052_A/Canada-ON/RV152      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229892744_A/Mexico/InDRE411      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229484050_A/Mexico/InDRE448      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229396423_A/California/08/2      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229535987_A/South_Carolina/      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229536131_A/Colorado/03/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229892752_A/Canada-NS/RV153      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229536102_A/Nebraska/02/200      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 444
gi|229892742_A/Canada-NS/RV153      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|229484048_A/Canada-NS/RV153      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
gi|237624329_A/swine/Alberta/O      NTNQQKASAGQISVQPTFSVQRNLPFERATVMAAFSGNNEGRTSDMRTEV 450
                                    *:************************************************

gi|229536005_A/Kansas/03/2009       IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229783384_A/New_York/1669/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536077_A/Indiana/09/2009      IRMMENAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227831778_A/California/06/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227831761_A/California/05/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229462701_A/Valencia/GP4/20      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229462713_A/Pais_Vasco/GP20      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229462689_A/Castilla-La_Man      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536066_A/Texas/07/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536024_A/Minnesota/02/20      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536038_A/Arizona/02/2009      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229783405_A/New_York/1682/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511891_A/Mexico/4486/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511915_A/Mexico/4108/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227977162_A/California/07/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536012_A/Arizona/01/2009      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229598884_A/Texas/15/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229299508_A/Texas/05/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227831792_A/Texas/05/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229299528_A/Texas/04/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227831819_A/Texas/04/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227977106_A/California/04/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|227809832_A/California/04/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396465_A/Texas/06/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229462725_A/Castilla-La_Man      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535799_A/Texas/09/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535951_A/Texas/08/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535999_A/Kansas/02/2009       IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511917_A/Mexico/4115/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536057_A/New_York/20/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396355_A/New_York/12/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536051_A/New_York/20/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396481_A/New_York/19/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511911_A/Mexico/4482/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511913_A/Mexico/4603/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511895_A/Mexico/4604/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229783369_A/Korea/01/2009        IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535818_A/California/14/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535905_A/Massachusetts/0      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536096_A/Massachusetts/0      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536109_A/Michigan/02/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536123_A/New_York/13/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535786_A/New_York/22/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396367_A/New_York/06/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396437_A/New_York/10/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396377_A/New_York/11/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396453_A/New_York/15/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396393_A/New_York/18/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396417_A/New_York/23/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396406_A/New_York/31/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229598873_A/Ohio/07/2009         IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229396492_A/Ohio/07/2009         IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|237511901_A/Mexico/4516/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229892750_A/Canada-AB/RV153      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229892746_A/Canada-ON/RV152      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229892748_A/Canada-ON/RV152      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229484052_A/Canada-ON/RV152      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229892744_A/Mexico/InDRE411      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229484050_A/Mexico/InDRE448      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229396423_A/California/08/2      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229535987_A/South_Carolina/      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229536131_A/Colorado/03/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229892752_A/Canada-NS/RV153      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229536102_A/Nebraska/02/200      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 494
gi|229892742_A/Canada-NS/RV153      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|229484048_A/Canada-NS/RV153      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
gi|237624329_A/swine/Alberta/O      IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAE 500
                                    *****.********************************************

gi|229536005_A/Kansas/03/2009       EYDS 498
gi|229783384_A/New_York/1669/2      EYDS 498
gi|229536077_A/Indiana/09/2009      EYDS 498
gi|227831778_A/California/06/2      EYDS 498
gi|227831761_A/California/05/2      EYDS 498
gi|229462701_A/Valencia/GP4/20      EYDS 498
gi|229462713_A/Pais_Vasco/GP20      EYDS 498
gi|229462689_A/Castilla-La_Man      EYDS 498
gi|229536066_A/Texas/07/2009        EYDS 498
gi|229536024_A/Minnesota/02/20      EYDS 498
gi|229536038_A/Arizona/02/2009      EYDS 498
gi|229783405_A/New_York/1682/2      EYDS 498
gi|237511891_A/Mexico/4486/200      EYDS 498
gi|237511915_A/Mexico/4108/200      EYDS 498
gi|227977162_A/California/07/2      EYDS 498
gi|229536012_A/Arizona/01/2009      EYDS 498
gi|229598884_A/Texas/15/2009        EYDS 498
gi|229299508_A/Texas/05/2009        EYDS 498
gi|227831792_A/Texas/05/2009        EYDS 498
gi|229299528_A/Texas/04/2009        EYDS 498
gi|227831819_A/Texas/04/2009        EYDS 498
gi|227977106_A/California/04/2      EYDS 498
gi|227809832_A/California/04/2      EYDS 498
gi|229396465_A/Texas/06/2009        EYDS 498
gi|229462725_A/Castilla-La_Man      EYDS 498
gi|229535799_A/Texas/09/2009        EYDS 498
gi|229535951_A/Texas/08/2009        EYDS 498
gi|229535999_A/Kansas/02/2009       EYDS 498
gi|237511917_A/Mexico/4115/200      EYDS 498
gi|229536057_A/New_York/20/200      EYDS 498
gi|229396355_A/New_York/12/200      EY-- 496
gi|229536051_A/New_York/20/200      EYDS 498
gi|229396481_A/New_York/19/200      EYDS 498
gi|237511911_A/Mexico/4482/200      EYDS 498
gi|237511913_A/Mexico/4603/200      EYDS 498
gi|237511895_A/Mexico/4604/200      EYDS 498
gi|229783369_A/Korea/01/2009        EYDS 498
gi|229535818_A/California/14/2      EYDS 498
gi|229535905_A/Massachusetts/0      EYDS 498
gi|229536096_A/Massachusetts/0      EYDS 498
gi|229536109_A/Michigan/02/200      EYDS 498
gi|229536123_A/New_York/13/200      EYDS 498
gi|229535786_A/New_York/22/200      EYDS 498
gi|229396367_A/New_York/06/200      EYDS 498
gi|229396437_A/New_York/10/200      EYDS 498
gi|229396377_A/New_York/11/200      EYDS 498
gi|229396453_A/New_York/15/200      EYDS 498
gi|229396393_A/New_York/18/200      EYDS 498
gi|229396417_A/New_York/23/200      EYDS 498
gi|229396406_A/New_York/31/200      EYDS 498
gi|229598873_A/Ohio/07/2009         EYDS 498
gi|229396492_A/Ohio/07/2009         EYDS 498
gi|237511901_A/Mexico/4516/200      EYDS 498
gi|229892750_A/Canada-AB/RV153      EYDS 504
gi|229892746_A/Canada-ON/RV152      EYDS 504
gi|229892748_A/Canada-ON/RV152      EYDS 504
gi|229484052_A/Canada-ON/RV152      EYDS 504
gi|229892744_A/Mexico/InDRE411      EYDS 504
gi|229484050_A/Mexico/InDRE448      EYDS 504
gi|229396423_A/California/08/2      EYDS 498
gi|229535987_A/South_Carolina/      EYDS 498
gi|229536131_A/Colorado/03/200      EYDS 498
gi|229892752_A/Canada-NS/RV153      EYDS 504
gi|229536102_A/Nebraska/02/200      EYDS 498
gi|229892742_A/Canada-NS/RV153      EYDS 504
gi|229484048_A/Canada-NS/RV153      EYDS 504
gi|237624329_A/swine/Alberta/O      EYDS 504
                                    **  

BLAST

>gb|ABA27433.1|  nucleoprotein [Influenza A virus (A/swine/MI/PU243/04 (H3N1))]
 gb|ABF17978.1|  nucleoprotein [Influenza A virus (A/Ontario/RV1273/2005(H3N2))]
 gb|ABF17979.1|  nucleoprotein [Influenza A virus (A/swine/Alberta/14722/2005(H3N2))]
 6 more sequence titles
 gb|ABF17980.1|  nucleoprotein [Influenza A virus (A/swine/British Columbia/28103/2005(H3N2))]
 gb|ABF17981.1|  nucleoprotein [Influenza A virus (A/swine/Manitoba/12707/2005(H3N2))]
 gb|ABF17982.1|  nucleoprotein [Influenza A virus (A/swine/Ontario/33853/2005(H3N2))]
 gb|ABF17983.1|  nucleoprotein [Influenza A virus (A/turkey/Ontario/31232/2005(H3N2))]
 gb|ABY70960.1|  nucleoprotein [Influenza A virus (A/Ontario/1252/2007(H3N2))]
 gb|ACF04394.1|  nucleocapsid protein [Influenza A virus (A/swine/Quebec/4001/2005(H3N2))]
Length=504

 Score = 1037 bits (2682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/504 (98%), Positives = 502/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVG+MIGGIG+FYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGKMIGGIGKFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|ABY81789.2|  nucleoprotein [Influenza A virus (A/swine/Korea/JNS06/2004(H3N2))]
Length=504

 Score = 1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/504 (98%), Positives = 502/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMA+QGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMATQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRTAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QR+LPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRSLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|AAL87891.1|AF455701_1  nucleoprotein [Influenza A virus (A/Swine/North Carolina/93523/01 
(H1N2))]
Length=504

 Score = 1036 bits (2680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/504 (98%), Positives = 501/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRTAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATV+AAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVLAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|ACF04386.1|  nucleocapsid protein [Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2))]
Length=504

 Score = 1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/504 (98%), Positives = 502/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVG+MIGGIG+FYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGKMIGGIGKFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFER+TVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERSTVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504

>gb|AAL87892.1|AF455702_1  nucleoprotein [Influenza A virus (A/Swine/Minnesota/55551/00 
(H1N2))]
Length=504

 Score = 1034 bits (2673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/504 (98%), Positives = 500/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQD TEIRASVGRMIGGIGRFYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDTTEIRASVGRMIGGIGRFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSF+GRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFKGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFF DNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFEDNAEEYDS  504


>gb|ABG34256.1|  nucleoprotein [Influenza A virus (A/swine/Korea/S11/2005(H1N2))]
Length=504

 Score = 1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/504 (97%), Positives = 501/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FY+QMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYVQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGT+AMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTVAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLAR+ALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARTALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNT+QQK SAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTSQQKTSAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|AAL87895.1|AF455705_1  nucleoprotein [Influenza A virus (A/Swine/Illinois/100085A/01 
(H1N2))]
Length=504

 Score = 1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/504 (98%), Positives = 500/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENG RTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGPRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKA +P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAASP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504



>gb|ACP44183.1|  nucleocapsid protein [Influenza A virus (A/California/07/2009(H1N1))]
Length=498

 Score = 1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/498 (99%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDK EIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKXEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            R ANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RLANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABA27441.1|  nucleoprotein [Influenza A virus (A/swine/IN/PU542/04 (H3N1))]
Length=504

 Score = 1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/504 (98%), Positives = 501/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLE+HP+AGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEDHPNAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV S +RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSXIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|ACH69553.1|  nucleocapsid protein [Influenza A virus (A/swine/OH/511445/2007(H1N1))]
Length=504

 Score = 1031 bits (2665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/504 (97%), Positives = 501/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRR+WRQANNG+DATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRIWRQANNGDDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTI MELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTITMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTE+IRMME+AKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEIIRMMENAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|ABG34249.1|  nucleoprotein [Influenza A virus (A/swine/Korea/S5/2005(H1N2))]
 gb|ABG34265.1|  nucleoprotein [Influenza A virus (A/swine/Korea/S15/2006(H1N2))]
Length=504

 Score = 1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/504 (97%), Positives = 500/504 (99%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FY+QMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYVQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKW+RELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWIRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGT+AMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTVAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVA KSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVARKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNT+QQK SAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTSQQKTSAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|ACF25041.1|  nucleocapsid protein [Influenza A virus (A/chicken/NY/21665-73/1998(H1N1))]
Length=498

 Score = 1028 bits (2659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 497/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            +DPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  VDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVETMDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVETMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAF73885.1|AF222775_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/238/97(H1N1))]
Length=498

 Score = 1028 bits (2657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 497/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNEN+ETMDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENIETMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAG01771.1|AF251415_1  nucleoprotein [Influenza A virus (A/Swine/Iowa/533/99 (H3N2))]
Length=498

 Score = 1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACI48765.1|  nucleocapsid protein [Influenza A virus (A/swine/Shanghai/1/2007(H1N2))]
Length=498

 Score = 1026 bits (2652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACE78008.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CAS08/2005(H1N1))]
Length=498

 Score = 1026 bits (2652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABR87894.1|  nucleoprotein [Influenza A virus (A/swine/Guangxi/13/2006(H1N2))]
Length=498

 Score = 1026 bits (2652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            E+ATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  EKATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABQ41899.1|  nucleoprotein [Influenza A virus (A/swine/North Carolina/2003(H3N2))]
Length=498

 Score = 1026 bits (2652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 497/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNE+PAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNEDPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAA51481.1|  nucleoprotein [Influenza A virus (A/swine/Nebraska/1/1992(H1N1))]
Length=498

 Score = 1026 bits (2652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACE78024.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CY07/2007(H3N2))]
 gb|ACE78026.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CY10/2007(H3N2))]
Length=498

 Score = 1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MA+QGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MATQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRTAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>sp|P68042.1|NCAP_I88A5  RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid protein; 
Short=Protein N
 sp|P68043.1|NCAP_I88A7  RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid protein; 
Short=Protein N
 gb|AAA52254.1|  nucleoprotein [Influenza A virus (A/Wisconsin/3523/1988(H1N1))]
 gb|AAA52267.1|  nucleoprotein [Influenza A virus (A/swine/Iowa/17672/1988(H1N1))]
 gb|ABR29599.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/17672/1988(H1N1))]
 gb|ABY84688.1|  nucleocapsid protein [Influenza A virus (A/swine/California/T9001707/1991(H1N1))]
 gb|ACF25600.1|  nucleocapsid protein [Influenza A virus (A/turkey/IA/21089-3/1992(H1N1))]
 gb|ACI26608.1|  nucleocapsid protein [Influenza A virus (A/swine/Memphis/1/1990(H1N1))]
Length=498

 Score = 1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACF17150.1|  nucleocapsid protein [Influenza A virus (A/swine/Hainan/1/2005(H1N2))]
Length=498

 Score = 1025 bits (2650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSD++GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDHEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACE78018.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CAS05/2004(H3N2))]
Length=498

 Score = 1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MA+QGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MATQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKG+GTIAMELIRMIKRGINDRNFWRGENGRRTR AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGIGTIAMELIRMIKRGINDRNFWRGENGRRTRTAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABU80404.1|  nucleocapsid protein [Influenza A virus (A/Ohio/3559/1988(H1N1))]
Length=498

 Score = 1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RG+QIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGIQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ABS50125.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/31483/1988(H1N1))]
Length=498

 Score = 1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAB50974.1|  nucleoprotein [Influenza A virus (A/swine/Beijing/94/1991(H1N1))]
 gb|ABR29569.1|  nucleocapsid protein [Influenza A virus (A/swine/Maryland/23239/1991(H1N1))]
Length=498

 Score = 1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLR+SSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRISSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ABC59712.1|  nucleoprotein [Influenza A virus (A/turkey/Ohio/313053/04(H3N2))]
 gb|ACD88663.1|  nucleocapsid protein [Influenza A virus (A/turkey/OH/313053/2004(H3N2))]
Length=498

 Score = 1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVG+MIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGKMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACE78022.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CY04/2007(H3N2))]
 gb|ACE78023.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CY05/2007(H3N2))]
 gb|ACE78025.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CY09/2007(H3N2))]
Length=498

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNSEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRTAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACE78007.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CAN01/2004(H1N1))]
Length=498

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRV+GKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACD88652.1|  nucleocapsid protein [Influenza A virus (A/turkey/NC/353568/2005(H3N2))]
Length=498

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVG+MIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGKMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABW71525.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/24297/1991(H1N1))]
Length=498

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAA51491.1|  nucleoprotein [Influenza A virus (A/MD/12/1991(H1N1))]
Length=498

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMA FSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAVFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAL87889.1|AF455699_1  nucleoprotein [Influenza A virus (A/Swine/Ohio/891/01(H1N2))]
 gb|AAL87896.1|AF455706_1  nucleoprotein [Influenza A virus (A/Swine/Illinois/100084/01 
(H1N2))]
Length=498

 Score = 1024 bits (2647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKA +PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAASPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAF73886.1|AF222776_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/457/98(H1N1))]
 gb|AAF73887.1|AF222777_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/458/98(H1N1))]
 gb|AAF73888.1|AF222778_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/464/98(H1N1))]
Length=498

 Score = 1024 bits (2647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MA+QGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MATQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTA+QRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTASQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERAT+MAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATIMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACE78019.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CAN04/2005(H3N2))]
 gb|ACE78021.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CAS09/2006(H3N2))]
Length=498

 Score = 1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQT AQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTTAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQ+ASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACF25610.1|  nucleocapsid protein [Influenza A virus (A/turkey/IA/10271-3/1990(H1N1))]
Length=498

 Score = 1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRE+ILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMREIILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENV+ MDSNTLELRSRYWAIRTRSGGNTNQQ+ASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVDAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACF25547.1|  nucleocapsid protein [Influenza A virus (A/turkey/MN/366767/2005(H3N2))]
Length=498

 Score = 1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            +TIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   MTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATV+AAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVLAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACD88707.1|  nucleocapsid protein [Influenza A virus (A/turkey/NC/19762/1988(H1N1))]
Length=498

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQAN+GEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANSGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAL87893.1|AF455703_1  nucleoprotein [Influenza A virus (A/Swine/Iowa/930/01(H1N2))]
Length=498

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIAS+ENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASSENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ER+T+MAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERSTIMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAG01780.1|AF251423_1  nucleoprotein [Influenza A virus (A/Swine/Iowa/569/99 (H3N2))]
Length=498

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLP RSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPIRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAA74749.1|  nucleoprotein [Influenza A virus (A/swine/IN/1726/1988(H1N1))]
 gb|AAA74750.1|  nucleoprotein [Influenza A virus (A/swine/WI/1915/1988(H1N1))]
 gb|ABR29589.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/1915/1988(H1N1))]
Length=498

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLVRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|AAF73879.1|AF222769_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/136/97(H1N1))]
Length=498

 Score = 1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMET GERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETSGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRN+PF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNIPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAZ79397.1|  nucleoprotein [Influenza A virus (A/swine/Zhejiang/1/2004(H1N2))]
Length=498

 Score = 1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRV+GKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLND+TYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDSTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLR+SSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRISSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQ+ASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAA73104.1|  nucleoprotein [Influenza A virus (A/Ohio/3523/1988(H1N1))]
Length=498

 Score = 1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RG+QIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGIQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKP DLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPVDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACF17145.1|  nucleocapsid protein [Influenza A virus (A/swine/Guangxi/17/2005(H1N2))]
Length=498

 Score = 1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMA HSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMARHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABR29579.1|  nucleocapsid protein [Influenza A virus (A/swine/Kansas/3228/1987(H1N1))]
 gb|ABU80424.1|  nucleocapsid protein [Influenza A virus (A/swine/Kansas/3024/1987(H1N1))]
Length=498

 Score = 1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|AAL87894.1|AF455704_1  nucleoprotein [Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2))]
Length=498

 Score = 1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            IT+ERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDK+EIRRVW
Sbjct  61   ITLERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKDEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFF DNAEEYDS
Sbjct  481  MSNEGSYFFEDNAEEYDS  498


>gb|ACI41026.1|  nucleocapsid protein [Influenza A virus (A/turkey/NC/17026/1988(H1N1))]
Length=498

 Score = 1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRN GNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNTGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ABI19011.1|  nucleoprotein [Influenza A virus (A/Iowa/CEID23/2005(H1N1))]
Length=498

 Score = 1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            IT+ERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITVERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGT+AMELIRMIKRGINDRNFWRGENGR+TR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTVAMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRG+LST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGRLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABR29609.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/3/1985(H1N1))]
 gb|ABR29619.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/1/1985(H1N1))]
 gb|ABW86600.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/2/1985(H1N1))]
Length=498

 Score = 1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RG+QIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGIQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABX58650.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/2/1987(H1N1))]
Length=498

 Score = 1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            +DPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  VDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNEN+E MDS+TLELRSRYWAIRTRSGGNT+QQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENMEAMDSSTLELRSRYWAIRTRSGGNTSQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACD35873.1|  nucleocapsid protein [Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2))]
Length=498

 Score = 1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVG+MIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGKMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE M SNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMGSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVI+MMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIKMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABI84662.1|  nucleocapsid protein [Influenza A virus (A/turkey/Minnesota/12537/1989(H1N1))]
Length=498

 Score = 1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIY+RVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQR+LPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRSLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACJ53886.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/C13/2008(H5N2))]
Length=498

 Score = 1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKL+DY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLNDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVA+GHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVANGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERAT+MAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATIMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEY+S
Sbjct  481  MSNEGSYFFGDNAEEYES  498


>gb|AAF73878.1|AF222768_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/125/97(H1N1))]
Length=498

 Score = 1021 bits (2639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMET GERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETSGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYR+VDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRKVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRN+PF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNIPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAA73112.1|  nucleoprotein [Influenza A virus (A/Wisconsin/3623/1988(H1N1))]
Length=498

 Score = 1021 bits (2639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF+GNNEGRTSDMRT +IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFAGNNEGRTSDMRTGIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAO88263.1|AF342819_1  nucleoprotein [Influenza A virus (A/Wisconsin/10/98 (H1N1))]
Length=498

 Score = 1021 bits (2639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPA+KSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAYKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPE LSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPETLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ABR28739.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/641/1980(H1N1))]
 gb|ABR28750.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/661/1980(H1N1))]
 gb|ABR28761.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/8/1980(H1N1))]
 gb|ABS49958.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/629/1980(H1N1))]
 gb|ABU80280.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/663/1980(H1N1))]
Length=498

 Score = 1020 bits (2638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABY81430.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/1/1986(H1N1))]
Length=498

 Score = 1020 bits (2638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMREL LYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELTLYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE+MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVESMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABS50115.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/1/1987(H1N1))]
Length=498

 Score = 1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RG+QIASNEN+E MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGIQIASNENMEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>sp|P26085.1|NCAP_I79A5  RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid protein; 
Short=Protein N
 gb|AAA52264.1|  nucleoprotein [Influenza A virus (A/swine/Italy/2/1979(H1N1))]
Length=498

 Score = 1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABI54394.1|  nucleoprotein [Influenza A virus (A/swine/Korea/PZ72-1/2006(H3N1))]
 gb|ABI54395.1|  nucleoprotein [Influenza A virus (A/swine/Korea/CN22/2006(H3N1))]
Length=498

 Score = 1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/497 (97%), Positives = 495/497 (99%), Gaps = 0/497 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKL+DY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLNDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVA+GHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVANGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERAT+MAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATIMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYD  503
            MSNEGSYFFGDNAEEY+
Sbjct  481  MSNEGSYFFGDNAEEYE  497


>gb|AAF73881.1|AF222771_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/164/97(H1N1))]
Length=498

 Score = 1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNSEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLVRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQ KASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQHKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGD+AEEYD+
Sbjct  481  MSNEGSYFFGDSAEEYDN  498


>gb|ABB86885.1|  nucleoprotein [Influenza A virus (A/swine/Alberta/56626/03(H1N1))]
Length=498

 Score = 1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMI GIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMINGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            IT+ERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIY+RVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITVERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASA QISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASASQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAA73111.1|  nucleoprotein [Influenza A virus (A/turkey/North Carolina/1790/1988(H1N1))]
Length=498

 Score = 1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAA 
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAV  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRG NGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGPNGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|AAF75997.1|AF250127_1  nucleoprotein [influenza A virus (A/Swine/Indiana/9K035/99 (H1N2))]
Length=498

 Score = 1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/498 (98%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQ S
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQIS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDE+RNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDEKRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRTAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>gb|ACE78010.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/JL01/2005(H1N2))]
 gb|ACE78013.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/Asan04/2006(H1N2))]
Length=498

 Score = 1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRR+W
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRIW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVR GMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNNEDATAGLTHIMIWHSNLNDATYQRTRALVRAGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLR+SSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRISSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE +DSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEALDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAF73880.1|AF222770_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/163/97(H1N1))]
 gb|AAF73882.1|AF222772_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/166/97(H1N1))]
Length=498

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNSEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQ KASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQHKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGD+AEEYD+
Sbjct  481  MSNEGSYFFGDSAEEYDN  498


>gb|ABR28640.1|  nucleocapsid protein [Influenza A virus (A/swine/Minnesota/5892-7/1979(H1N1))]
Length=498

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKL+DY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLNDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABY40429.1|  nucleoprotein [Influenza A virus (A/swine/Missouri/2124514/2006(H2N3))]
Length=498

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            +TIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   MTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGL HIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLAHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGR+TR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRG+LST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGRLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABB86905.1|  nucleoprotein [Influenza A virus (A/swine/Ontario/53518/03(H1N1))]
Length=498

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/498 (97%), Positives = 496/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIAS+ENVE MDSNTLELRSRYWAIRT+SGGNT+QQKASAGQISVQPTFSVQRN+PF
Sbjct  361  RGVQIASSENVEAMDSNTLELRSRYWAIRTKSGGNTSQQKASAGQISVQPTFSVQRNIPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ER+T+M+AFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERSTIMSAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABB86935.1|  nucleoprotein [Influenza A virus (A/swine/Ontario/23866/04(H1N1))]
Length=498

 Score = 1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRM+GGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIAS+E VE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASSETVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ER+T+MAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERSTIMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYD+
Sbjct  481  MSNEGSYFFGDNAEEYDN  498


>sp|P15679.2|NCAP_I77AC  RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid protein; 
Short=Protein N
 gb|AAA43455.1|  nucleoprotein [Influenza A virus (A/swine/Tennessee/24/1977(H1N1))]
 gb|ABD95716.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/25/1977(H1N1))]
 12 more sequence titles
 gb|ABR28552.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/62/1977(H1N1))]
 gb|ABR28574.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/79/1977(H1N1))]
 gb|ABR28662.1|  nucleocapsid protein [Influenza A virus (A/swine/Ontario/4/1981(H1N1))]
 gb|ABR28673.1|  nucleocapsid protein [Influenza A virus (A/swine/Ontario/7/1981(H1N1))]
 gb|ABR28717.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/11/1980(H1N1))]
 gb|ABS49936.1|  nucleocapsid protein [Influenza A virus (A/swine/Ontario/1/1981(H1N1))]
 gb|ABU80203.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/61/1977(H1N1))]
 gb|ABU80214.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/96/1977(H1N1))]
 gb|ABW36337.1|  nucleocapsid protein [Influenza A virus (A/swine/Ontario/2/1981(H1N1))]
 gb|ABW36348.1|  nucleocapsid protein [Influenza A virus (A/swine/Ontario/3/1981(H1N1))]
 gb|ABW36359.1|  nucleocapsid protein [Influenza A virus (A/swine/Ontario/6/1981(H1N1))]
 gb|ABW36381.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/100/1977(H1N1))]
Length=498

 Score = 1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABB86895.1|  nucleoprotein [Influenza A virus (A/swine/Ontario/55383/04(H1N2))]
Length=504

 Score = 1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/504 (96%), Positives = 497/504 (98%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQM TELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMRTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERM LSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR +GKWMRELILYDKE
Sbjct  61   RLIQNSITIERMALSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRANGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQAN GEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANVGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESRNPGNAEIEDLIFLARSALILRG+VAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGAVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLR+SSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRISSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRG+QIAS+ENVE MDSNTLELRSRYWAIRTRSGGNTNQQKAS+GQISVQPTFSV
Sbjct  361  RGKLSTRGIQIASSENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASSGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFER+T+MAAF GNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP
Sbjct  421  QRNLPFERSTIMAAFRGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|AAF73883.1|AF222773_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/168/97(H1N1))]
Length=498

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MA+QGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MATQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNSEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQ KASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQHKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGD+AEEYD+
Sbjct  481  MSNEGSYFFGDSAEEYDN  498


>sp|P26084.1|NCAP_I76AG  RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid protein; 
Short=Protein N
 gb|AAA52263.1|  nucleoprotein [Influenza A virus (A/swine/Italy/437/1976(H1N1))]
 gb|ABQ45418.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/3/1976(H1N1))]
 31 more sequence titles
 gb|ABQ45429.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/7/1976(H1N1))]
 gb|ABQ45440.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/15/1976(H1N1))]
 gb|ABQ45451.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/17/1976(H1N1))]
 gb|ABR15834.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/19/1977(H1N1))]
 gb|ABR15845.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/21/1977(H1N1))]
 gb|ABR15856.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/31/1977(H1N1))]
 gb|ABR15867.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/49/1977(H1N1))]
 gb|ABR15878.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/64/1977(H1N1))]
 gb|ABR28541.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/10/1977(H1N1))]
 gb|ABR28563.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/65/1977(H1N1))]
 gb|ABR28585.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/82/1977(H1N1))]
 gb|ABR28618.1|  nucleocapsid protein [Influenza A virus (A/swine/Kentucky/1/1976(H1N1))]
 gb|ABR28651.1|  nucleocapsid protein [Influenza A virus (A/swine/Nebraska/123/1977(H1N1))]
 gb|ABR28695.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/11/1978(H1N1))]
 gb|ABU80225.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/84/1977(H1N1))]
 gb|ABU80236.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/86/1977(H1N1))]
 gb|ABU80247.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/87/1977(H1N1))]
 gb|ABU80258.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/88/1977(H1N1))]
 gb|ABU80269.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/10/1978(H1N1))]
 gb|ABU80414.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/48/1977(H1N1))]
 gb|ABV29528.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/37/1977(H1N1))]
 gb|ABV45842.1|  nucleocapsid protein [Influenza A virus (A/Wisconsin/301/1976(H1N1))]
 gb|ABW36326.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/23/1976(H1N1))]
 gb|ABW36370.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/10/1976(H1N1))]
 gb|ABW71507.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/2/1978(H1N1))]
 gb|ABW86578.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/5/1978(H1N1))]
 gb|ABW86589.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/8/1978(H1N1))]
 gb|ABX58672.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/30747/1976(H1N1))]
 gb|ABY51208.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/4/1978(H1N1))]
 gb|ABY51219.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/7/1978(H1N1))]
 gb|ACA96534.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/9/1978(H1N1))]
Length=498

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|AAL87890.1|AF455700_1  nucleoprotein [Influenza A virus (A/Swine/North Carolina/98225/01(H1N2))]
Length=504

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/504 (96%), Positives = 496/504 (98%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKG+GTIAM LIRMIKRGINDR+FWRGENGRRTR+A ERMCN+LKGKFQT A
Sbjct  181  RSGAAGAAVKGIGTIAMGLIRMIKRGINDRDFWRGENGRRTRIACERMCNVLKGKFQTTA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            Q AMMDQVRESRNPGNAEIE  IFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QXAMMDQVRESRNPGNAEIEXXIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQ+ASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|AAG01789.1|AF251431_1  nucleoprotein [Influenza A virus (A/Swine/Minnesota/593/99 (H3N2))]
Length=498

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGY LVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYLLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+R NENPA+KSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRLNENPAYKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>dbj|BAG49623.1|  nucleoprotein [Influenza A virus (A/swine/Miyazaki/1/2006(H1N2))]
Length=504

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/504 (96%), Positives = 498/504 (98%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIE MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+G
Sbjct  1    MSDIEIMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMREL LYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELTLYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKG+GTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGIGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMDQVRESR+PGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDQVRESRSPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVG+DPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+P
Sbjct  301  GYSLVGVDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGKLSTRGVQIASNE+VE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKLSTRGVQIASNESVENMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAF GNNEGRTSDMRTE+IRMME+AKPED+SFQGRGVFELSDEKATNP
Sbjct  421  QRNLPFERATVMAAFIGNNEGRTSDMRTEIIRMMENAKPEDVSFQGRGVFELSDEKATNP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDM+NEGSYFFGDNAEEYD+
Sbjct  481  IVPSFDMNNEGSYFFGDNAEEYDN  504


>gb|ABY40441.1|  nucleoprotein [Influenza A virus (A/swine/Missouri/4296424/2006(H2N3))]
Length=498

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/498 (97%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            +TIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   MTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGL HIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLAHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGT+AMELIRMIKRGINDRNFWRGENGR+TR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTVAMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRG+LST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGRLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERAT+MAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATIMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACE78009.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2))]
 gb|ACE78012.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/JL04/2005(H1N2))]
Length=498

 Score = 1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRR+W
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRIW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVR GMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNNEDATAGLTHIMIWHSNLNDATYQRTRALVRAGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLR+SSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRISSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE +DSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEALDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEE+DS
Sbjct  481  MSNEGSYFFGDNAEEFDS  498


>gb|ACE78011.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/JL02/2005(H1N2))]
 gb|ACE78014.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/PZ4/2006(H1N2))]
 gb|ACE78015.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/PZ7/2006(H1N2))]
 gb|ACE78016.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/PZ14/2006(H1N2))]
 gb|ACE78017.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CY08/2007(H1N2))]
Length=498

 Score = 1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANN EDATAGLTHIMIWHSNLNDATYQRTRALVR GMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNNEDATAGLTHIMIWHSNLNDATYQRTRALVRAGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLR+SSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRISSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNE+VE +DSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNESVEALDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERAT+MAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATIMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|AAF73884.1|AF222774_1  nucleoprotein [Influenza A virus (A/Swine/Wisconsin/235/97(H1N1))]
Length=498

 Score = 1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLVRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLP 
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPL  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            E +TVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ESSTVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGD+AEEYD+
Sbjct  481  MSNEGSYFFGDSAEEYDN  498


>gb|ABR28629.1|  nucleocapsid protein [Influenza A virus (A/swine/Minnesota/27/1976(H1N1))]
 gb|ABU80192.1|  nucleocapsid protein [Influenza A virus (A/swine/Minnesota/24/1975(H1N1))]
Length=498

 Score = 1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            +DPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  VDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|AAN46830.1|  nucleoprotein [Influenza A virus (A/Swine/Korea/CY02/02(H1N2))]
Length=504

 Score = 1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/504 (97%), Positives = 494/504 (98%), Gaps = 0/504 (0%)

Query  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDG  60
            MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+G
Sbjct  1    MSDIEAMASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEG  60

Query  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120
            RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE
Sbjct  61   RLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKE  120

Query  121  EIRRVWRQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPR  180
            EIRRVWRQANN EDATAGLTHIMIWHSNLNDATYQRTRALVR GMDPRMCSLMQGSTLPR
Sbjct  121  EIRRVWRQANNNEDATAGLTHIMIWHSNLNDATYQRTRALVRAGMDPRMCSLMQGSTLPR  180

Query  181  RSGAAGAAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAA  240
            RSGAAGAAVKGVGTIAMELIRMIKRGIN RNFWRGENGRRTR+AYERMCNILKGKFQTAA
Sbjct  181  RSGAAGAAVKGVGTIAMELIRMIKRGINGRNFWRGENGRRTRIAYERMCNILKGKFQTAA  240

Query  241  QRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300
            QRAMMD VRESRNPG AEIED IFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE
Sbjct  241  QRAMMDPVRESRNPGTAEIEDFIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFERE  300

Query  301  GYSLVGIDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIP  360
            GYSLVGIDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFED RVSSFIRGKKVIP
Sbjct  301  GYSLVGIDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDPRVSSFIRGKKVIP  360

Query  361  RGKLSTRGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420
            RGK STRGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV
Sbjct  361  RGKPSTRGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSV  420

Query  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNP  480
            QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+P
Sbjct  421  QRNLPFERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSP  480

Query  481  IVPSFDMSNEGSYFFGDNAEEYDS  504
            IVPSFDMSNEGSYFFGDNAEEYDS
Sbjct  481  IVPSFDMSNEGSYFFGDNAEEYDS  504


>gb|ABA46961.1|  nucleoprotein [Influenza A virus (A/swine/Minnesota/00395/2004(H3N1))]
Length=495

 Score = 1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/495 (98%), Positives = 493/495 (99%), Gaps = 0/495 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEE  501
            MSNEGSYFFGDNAEE
Sbjct  481  MSNEGSYFFGDNAEE  495


>gb|ABR28728.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/2/1970(H1N1))]
 gb|ABV82588.1|  nucleocapsid protein [Influenza A virus (A/swine/Wisconsin/1/1967(H1N1))]
Length=498

 Score = 1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/498 (97%), Positives = 493/498 (98%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTI MELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFVGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ACE78020.1|  nucleocapsid protein [Influenza A virus (A/swine/Korea/CAS07/2005(H3N2))]
Length=498

 Score = 1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/498 (97%), Positives = 493/498 (98%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEI RVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIGRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQAN GEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANIGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQT AQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTTAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQ+ASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ABX58661.1|  nucleocapsid protein [Influenza A virus (A/swine/Tennessee/3/1978(H1N1))]
Length=498

 Score = 1017 bits (2629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            +RATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  DRATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABQ45462.1|  nucleocapsid protein [Influenza A virus (A/swine/Iowa/1/1976(H1N1))]
Length=498

 Score = 1017 bits (2629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/498 (97%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRR+DGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRIDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPI+PSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPILPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ACD88520.1|  nucleocapsid protein [Influenza A virus (A/turkey/KS/4880/1980(H1N1))]
 gb|ACD88696.1|  nucleocapsid protein [Influenza A virus (A/chicken/PA/35154/1991(H1N1))]
Length=498

 Score = 1017 bits (2629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/498 (97%), Positives = 493/498 (98%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRM+GGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTI MELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTITMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVS FIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSGFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDS+TLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSSTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATVMAAF GNNEGRTSDMRTE+IRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERATVMAAFIGNNEGRTSDMRTEIIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEEYD+
Sbjct  481  MNNEGSYFFGDNAEEYDN  498


>gb|ABB86875.1|  nucleoprotein [Influenza A virus (A/swine/Ontario/57561/03(H1N1))]
Length=498

 Score = 1016 bits (2628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/498 (96%), Positives = 495/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRM+GGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            ITIERM LSAFDERRN+YLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITIERMALSAFDERRNRYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIAS+ENVE MDSNTLELRSRYWAIRT+SGGNT+QQKASAGQISVQPTFSVQRN+PF
Sbjct  361  RGVQIASSENVEAMDSNTLELRSRYWAIRTKSGGNTSQQKASAGQISVQPTFSVQRNIPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ER+T+M+AFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERSTIMSAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>gb|ACD35866.1|  nucleocapsid protein [Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2))]
Length=498

 Score = 1016 bits (2628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/498 (97%), Positives = 493/498 (98%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIG+FYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGKFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            +TIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   MTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            I PFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST
Sbjct  301  IGPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTF VQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFPVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ERATV+AAFSGNNEGRTSDMRTEVIRMMES KPEDLSFQGRGVFELSDEKAT+PIVPSFD
Sbjct  421  ERATVLAAFSGNNEGRTSDMRTEVIRMMESVKPEDLSFQGRGVFELSDEKATSPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            MSNEGSYFFGDNAEEYDS
Sbjct  481  MSNEGSYFFGDNAEEYDS  498


>dbj|BAH02121.1|  nucleoprotein [Influenza A virus (A/swine/Nakhon pathom/NIAH586-1/2005(H3N2))]
Length=498

 Score = 1016 bits (2628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/498 (96%), Positives = 494/498 (99%), Gaps = 0/498 (0%)

Query  7    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYDGRLIQNS  66
            MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDY+GRLIQNS
Sbjct  1    MASQGTKRSYEQMETGGERQDATEIRASVGRMIGGIGRFYIQMCTELKLSDYEGRLIQNS  60

Query  67   ITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  126
            IT+ERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW
Sbjct  61   ITLERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRVW  120

Query  127  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  186
            RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG
Sbjct  121  RQANNGEDATAGLTHIMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG  180

Query  187  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRRTRVAYERMCNILKGKFQTAAQRAMMD  246
            AAVKGVGTIAMELIRMIKRGINDRNFWRGENGR+TR+AYERMCNILKGKFQTAAQRAMMD
Sbjct  181  AAVKGVGTIAMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMD  240

Query  247  QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  306
            QVRESRNPGNAEIEDLIFL RSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG
Sbjct  241  QVRESRNPGNAEIEDLIFLTRSALILRGSVAHKSCLPACVYGLAVASGHDFEREGYSLVG  300

Query  307  IDPFKLLQNSQVVSLMRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVIPRGKLST  366
            IDPFKLLQNSQV SL+RPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKV+PRGKLST
Sbjct  301  IDPFKLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGKKVVPRGKLST  360

Query  367  RGVQIASNENVETMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQISVQPTFSVQRNLPF  426
            RGVQIASNENVE MDSNTLELRSRYWAIRTRSGGNTNQQKASAGQ+SVQPTFSVQRNLPF
Sbjct  361  RGVQIASNENVEAMDSNTLELRSRYWAIRTRSGGNTNQQKASAGQVSVQPTFSVQRNLPF  420

Query  427  ERATVMAAFSGNNEGRTSDMRTEVIRMMESAKPEDLSFQGRGVFELSDEKATNPIVPSFD  486
            ER T+MAAFSGNNEGRTSDMRTEVIRMME+AKPEDLSFQGRGVFELSDEKATNPIVPSFD
Sbjct  421  ERTTIMAAFSGNNEGRTSDMRTEVIRMMENAKPEDLSFQGRGVFELSDEKATNPIVPSFD  480

Query  487  MSNEGSYFFGDNAEEYDS  504
            M+NEGSYFFGDNAEE+D+
Sbjct  481  MNNEGSYFFGDNAEEFDN  498

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools