User:Michael Strong/H1N1/NS

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

NS1 Protein Structural Homolgy Model

NS1 Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 NS1, residues 5-202, 84% sequence identity to pdp template 3f5t

NS1 Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
NS1 D12E 229536107_A/Nebraska/02/200 1
NS1 F32L 229535811_A/Texas/09/2009 1
NS1 G45R 229598886_A/Texas/15/2009 1
NS1 R88C 229536033_A/Minnesota/02/20 1
NS1 E97G 229892754_A/Canada-NS/RV153 1
NS1 M104T 237624336_A/swine/Alberta/O 1
NS1 I123V 229892764_A/Canada-AB/RV153 15
NS1 F134I 237624336_A/swine/Alberta/O 1

NS1 Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of NS1 Protein, 53 sequences

gi|229598886_A/Texas/15/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKRRGNTL 50
gi|229892754_A/Canada-NS/RV153      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229536033_A/Minnesota/02/20      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229536107_A/Nebraska/02/200      MDSNTMSSFQVECFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229535811_A/Texas/09/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPLLDRLRRDQKSLKGRGNTL 50
gi|229396500_A/Ohio/07/2009         MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396477_A/New_York/19/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396402_A/New_York/31/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396413_A/New_York/23/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396387_A/New_York/18/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396449_A/New_York/15/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396351_A/New_York/12/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396373_A/New_York/11/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396433_A/New_York/10/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396363_A/New_York/06/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229484061_A/Canada-ON/RV152      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229535829_A/California/14/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229892761_A/Canada-ON/RV152      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229892770_A/Canada-ON/RV152      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229892764_A/Canada-AB/RV153      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|237511869_A/Mexico/4108/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|237511872_A/Mexico/4115/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|237511860_A/Mexico/4486/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|237511866_A/Mexico/4603/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|237511857_A/Mexico/4604/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229892767_A/Canada-NS/RV153      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229892758_A/Mexico/InDRE411      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229783375_A/Korea/01/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229783386_A/New_York/1669/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229783407_A/New_York/1682/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229536016_A/Arizona/01/2009      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229536115_A/Michigan/02/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229535991_A/South_Carolina/      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229462691_A/Castilla-La          MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229462727_A/Castilla-La          MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229462715_A/Pais_Vasco/GP20      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229462703_A/Valencia/GP4/20      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229484054_A/Canada-NS/RV153      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229484058_A/Mexico/InDRE448      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229368684_A/Denmark/513/200      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229396460_A/Texas/06/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229536007_A/Kansas/03/2009       MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227977123_A/California/08/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227977155_A/California/08/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227809839_A/California/04/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227977111_A/California/04/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|228017753_A/California/06/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227977143_A/California/07/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227977167_A/California/07/2      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229299532_A/Texas/04/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|227831789_A/Texas/05/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|229299512_A/Texas/05/2009        MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
gi|237624336_A/swine/Alberta/O      MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL 50
                                    ***********:*******************:************ *****

gi|229598886_A/Texas/15/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229892754_A/Canada-NS/RV153      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEGMSR 100
gi|229536033_A/Minnesota/02/20      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSCYLSDMTLEEMSR 100
gi|229536107_A/Nebraska/02/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229535811_A/Texas/09/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396500_A/Ohio/07/2009         GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396477_A/New_York/19/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396402_A/New_York/31/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396413_A/New_York/23/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396387_A/New_York/18/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396449_A/New_York/15/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396351_A/New_York/12/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396373_A/New_York/11/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396433_A/New_York/10/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396363_A/New_York/06/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229484061_A/Canada-ON/RV152      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229535829_A/California/14/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229892761_A/Canada-ON/RV152      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229892770_A/Canada-ON/RV152      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229892764_A/Canada-AB/RV153      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|237511869_A/Mexico/4108/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|237511872_A/Mexico/4115/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|237511860_A/Mexico/4486/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|237511866_A/Mexico/4603/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|237511857_A/Mexico/4604/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229892767_A/Canada-NS/RV153      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229892758_A/Mexico/InDRE411      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229783375_A/Korea/01/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229783386_A/New_York/1669/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229783407_A/New_York/1682/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229536016_A/Arizona/01/2009      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229536115_A/Michigan/02/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229535991_A/South_Carolina/      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229462691_A/Castilla-La          GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229462727_A/Castilla-La          GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229462715_A/Pais_Vasco/GP20      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229462703_A/Valencia/GP4/20      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229484054_A/Canada-NS/RV153      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229484058_A/Mexico/InDRE448      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229368684_A/Denmark/513/200      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229396460_A/Texas/06/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229536007_A/Kansas/03/2009       GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227977123_A/California/08/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227977155_A/California/08/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227809839_A/California/04/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227977111_A/California/04/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|228017753_A/California/06/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227977143_A/California/07/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227977167_A/California/07/2      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229299532_A/Texas/04/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|227831789_A/Texas/05/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|229299512_A/Texas/05/2009        GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
gi|237624336_A/swine/Alberta/O      GLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSR 100
                                    ************************************* ******** ***

gi|229598886_A/Texas/15/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229892754_A/Canada-NS/RV153      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229536033_A/Minnesota/02/20      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229536107_A/Nebraska/02/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229535811_A/Texas/09/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396500_A/Ohio/07/2009         DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396477_A/New_York/19/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396402_A/New_York/31/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396413_A/New_York/23/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396387_A/New_York/18/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396449_A/New_York/15/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396351_A/New_York/12/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396373_A/New_York/11/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396433_A/New_York/10/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396363_A/New_York/06/200      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229484061_A/Canada-ON/RV152      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229535829_A/California/14/2      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229892761_A/Canada-ON/RV152      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229892770_A/Canada-ON/RV152      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229892764_A/Canada-AB/RV153      DWFMLMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|237511869_A/Mexico/4108/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|237511872_A/Mexico/4115/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|237511860_A/Mexico/4486/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|237511866_A/Mexico/4603/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|237511857_A/Mexico/4604/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229892767_A/Canada-NS/RV153      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229892758_A/Mexico/InDRE411      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229783375_A/Korea/01/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229783386_A/New_York/1669/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229783407_A/New_York/1682/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229536016_A/Arizona/01/2009      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229536115_A/Michigan/02/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229535991_A/South_Carolina/      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229462691_A/Castilla-La          DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229462727_A/Castilla-La          DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229462715_A/Pais_Vasco/GP20      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229462703_A/Valencia/GP4/20      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229484054_A/Canada-NS/RV153      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229484058_A/Mexico/InDRE448      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229368684_A/Denmark/513/200      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229396460_A/Texas/06/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229536007_A/Kansas/03/2009       DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227977123_A/California/08/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227977155_A/California/08/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227809839_A/California/04/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227977111_A/California/04/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|228017753_A/California/06/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227977143_A/California/07/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227977167_A/California/07/2      DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229299532_A/Texas/04/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|227831789_A/Texas/05/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|229299512_A/Texas/05/2009        DWFMLMPRQKIIGPLCVRLDQAIMEKNIVLKANFSVIFNRLETLILLRAF 150
gi|237624336_A/swine/Alberta/O      DWFTLMPRQKIIGPLCVRLDQAIMEKNIVLKANISVIFNRLETLILLRAF 150
                                    *** ******************:**********:****************

gi|229598886_A/Texas/15/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229892754_A/Canada-NS/RV153      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229536033_A/Minnesota/02/20      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229536107_A/Nebraska/02/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229535811_A/Texas/09/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396500_A/Ohio/07/2009         TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396477_A/New_York/19/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396402_A/New_York/31/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396413_A/New_York/23/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396387_A/New_York/18/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396449_A/New_York/15/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396351_A/New_York/12/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396373_A/New_York/11/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396433_A/New_York/10/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396363_A/New_York/06/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229484061_A/Canada-ON/RV152      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229535829_A/California/14/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229892761_A/Canada-ON/RV152      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229892770_A/Canada-ON/RV152      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229892764_A/Canada-AB/RV153      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|237511869_A/Mexico/4108/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|237511872_A/Mexico/4115/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|237511860_A/Mexico/4486/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|237511866_A/Mexico/4603/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|237511857_A/Mexico/4604/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229892767_A/Canada-NS/RV153      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229892758_A/Mexico/InDRE411      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229783375_A/Korea/01/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229783386_A/New_York/1669/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229783407_A/New_York/1682/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229536016_A/Arizona/01/2009      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229536115_A/Michigan/02/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229535991_A/South_Carolina/      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229462691_A/Castilla-La          TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229462727_A/Castilla-La          TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229462715_A/Pais_Vasco/GP20      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229462703_A/Valencia/GP4/20      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229484054_A/Canada-NS/RV153      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229484058_A/Mexico/InDRE448      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229368684_A/Denmark/513/200      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229396460_A/Texas/06/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229536007_A/Kansas/03/2009       TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227977123_A/California/08/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227977155_A/California/08/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227809839_A/California/04/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227977111_A/California/04/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|228017753_A/California/06/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227977143_A/California/07/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227977167_A/California/07/2      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229299532_A/Texas/04/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|227831789_A/Texas/05/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|229299512_A/Texas/05/2009        TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
gi|237624336_A/swine/Alberta/O      TEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQR 200
                                    **************************************************

gi|229598886_A/Texas/15/2009        FAWRNCDENGRPSLPPEQK 219
gi|229892754_A/Canada-NS/RV153      FAWRNCDENGRPSLPPEQK 219
gi|229536033_A/Minnesota/02/20      FAWRNCDENGRPSLPPEQK 219
gi|229536107_A/Nebraska/02/200      FAWRNCDENGRPSLPPEQK 219
gi|229535811_A/Texas/09/2009        FAWRNCDENGRPSLPPEQK 219
gi|229396500_A/Ohio/07/2009         FAWRNCDENGRPSLPPEQK 219
gi|229396477_A/New_York/19/200      FAWRNCDENGRPSLPPEQK 219
gi|229396402_A/New_York/31/200      FAWRNCDENGRPSLPPEQK 219
gi|229396413_A/New_York/23/200      FAWRNCDENGRPSLPPEQK 219
gi|229396387_A/New_York/18/200      FAWRNCDENGRPSLPPEQK 219
gi|229396449_A/New_York/15/200      FAWRNCDENGRPSLPPEQK 219
gi|229396351_A/New_York/12/200      FAWRNCDENGRPSLPPEQK 219
gi|229396373_A/New_York/11/200      FAWRNCDENGRPSLPPEQK 219
gi|229396433_A/New_York/10/200      FAWRNCDENGRPSLPPEQK 219
gi|229396363_A/New_York/06/200      FAWRNCDENGRPSLPPEQK 219
gi|229484061_A/Canada-ON/RV152      FAWRNCDENGRPSLPPEQK 219
gi|229535829_A/California/14/2      FAWRNCDENGRPSLPPEQK 219
gi|229892761_A/Canada-ON/RV152      FAWRNCDENGRPSLPPEQK 219
gi|229892770_A/Canada-ON/RV152      FAWRNCDENGRPSLPPEQK 219
gi|229892764_A/Canada-AB/RV153      FAWRNCDENGRPSLPPEQK 219
gi|237511869_A/Mexico/4108/200      FAWRNCDENGRPSLPPEQK 219
gi|237511872_A/Mexico/4115/200      FAWRNCDENGRPSLPPEQK 219
gi|237511860_A/Mexico/4486/200      FAWRNCDENGRPSLPPEQK 219
gi|237511866_A/Mexico/4603/200      FAWRNCDENGRPSLPPEQK 219
gi|237511857_A/Mexico/4604/200      FAWRNCDENGRPSLPPEQK 219
gi|229892767_A/Canada-NS/RV153      FAWRNCDENGRPSLPPEQK 219
gi|229892758_A/Mexico/InDRE411      FAWRNCDENGRPSLPPEQK 219
gi|229783375_A/Korea/01/2009        FAWRNCDENGRPSLPPEQK 219
gi|229783386_A/New_York/1669/2      FAWRNCDENGRPSLPPEQK 219
gi|229783407_A/New_York/1682/2      FAWRNCDENGRPSLPPEQK 219
gi|229536016_A/Arizona/01/2009      FAWRNCDENGRPSLPPEQK 219
gi|229536115_A/Michigan/02/200      FAWRNCDENGRPSLPPEQK 219
gi|229535991_A/South_Carolina/      FAWRNCDENGRPSLPPEQK 219
gi|229462691_A/Castilla-La          FAWRNCDENGRPSLPPEQK 219
gi|229462727_A/Castilla-La          FAWRNCDENGRPSLPPEQK 219
gi|229462715_A/Pais_Vasco/GP20      FAWRNCDENGRPSLPPEQK 219
gi|229462703_A/Valencia/GP4/20      FAWRNCDENGRPSLPPEQK 219
gi|229484054_A/Canada-NS/RV153      FAWRNCDENGRPSLPPEQK 219
gi|229484058_A/Mexico/InDRE448      FAWRNCDENGRPSLPPEQK 219
gi|229368684_A/Denmark/513/200      FAWRNCDENGRPSLPPEQK 219
gi|229396460_A/Texas/06/2009        FAWRNCDENGRPSLPPEQK 219
gi|229536007_A/Kansas/03/2009       FAWRNCDENGRPSLPPEQK 219
gi|227977123_A/California/08/2      FAWRNCDENGRPSLPPEQK 219
gi|227977155_A/California/08/2      FAWRNCDENGRPSLPPEQK 219
gi|227809839_A/California/04/2      FAWRNCDENGRPSLPPEQK 219
gi|227977111_A/California/04/2      FAWRNCDENGRPSLPPEQK 219
gi|228017753_A/California/06/2      FAWRNCDENGRPSLPPEQK 219
gi|227977143_A/California/07/2      FAWRNCDENGRPSLPPEQK 219
gi|227977167_A/California/07/2      FAWRNCDENGRPSLPPEQK 219
gi|229299532_A/Texas/04/2009        FAWRNCDENGRPSLPPEQK 219
gi|227831789_A/Texas/05/2009        FAWRNCDENGRPSLPPEQK 219
gi|229299512_A/Texas/05/2009        FAWRNCDENGRPSLPPEQK 219
gi|237624336_A/swine/Alberta/O      FAWRNCDENGRPSLPPEQK 219
                                    *******************

NS1 BLAST


>gb|AAL87905.1|AF455711_1  nonstructural protein 1 [Influenza A virus (A/Swine/Iowa/930/01(H1N2))]
Length=219

 Score =  432 bits (1111),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 217/219 (99%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMT+EEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTIEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRNC+E+GRPSLPP+QK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNCNEDGRPSLPPKQK  219


>gb|AAD51273.1|AF153261_1  NS1 [Influenza A virus (A/Swine/Texas/4199-2/98(H3N2))]
 gb|AAD51275.1|AF153262_1  NS1 [influenza A virus (A/Swine/Minnesota/9088-2/98 (H3N2))]
Length=219

 Score =  430 bits (1105),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 208/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAF75999.1|AF250128_2  NS1 [influenza A virus (A/Swine/Indiana/9K035/99 (H1N2))]
Length=219

 Score =  429 bits (1102),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVG+
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGI  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +ENGRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNENGRPSLSPEQK  219


>gb|AAL29798.1|  nonstructural protein [Influenza A virus (A/SW/IN/14810-T/01(H1N2))]
 gb|AAL29799.1|  nonstructural protein [Influenza A virus (A/SW/IN/14810-S/01(H1N2))]
Length=219

 Score =  429 bits (1102),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTL+EMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLKEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABI54396.1|  nonstructural protein [Influenza A virus (A/swine/Korea/PZ72-1/2006(H3N1))]
 gb|ABI54397.1|  nonstructural protein [Influenza A virus (A/swine/Korea/CN22/2006(H3N1))]
Length=219

 Score =  428 bits (1101),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAF+EEGAIVGEISPLPSLPGHT EDVKNA+GV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFSEEGAIVGEISPLPSLPGHTNEDVKNAIGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            L+GGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LVGGLEWNGNTVRGSENLQRFAWRNHNEDGRPSLPPEQK  219


>gb|ABA27444.1|  nonstructural protein [Influenza A virus (A/swine/IN/PU542/04 
(H3N1))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNT+GLDIETATL+
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTIGLDIETATLI  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSV+FNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVVFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAK71694.1|  nonstructural protein 1 [Influenza A virus (A/Turkey/MO/24093/99(H1N2))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAD51277.1|AF153263_1  NS1 [influenza A virus (A/Swine/Iowa/8548-1/98)]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACH69556.1|  nonstructural protein 1 [Influenza A virus (A/swine/OH/511445/2007(H1N1))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWIL+EESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGP CV++D
Sbjct  61   GKQIVEWILREESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPFCVQMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +ENGRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNENGRPSLPPEQK  219


>gb|AAL87903.1|AF455710_1  nonstructural protein 1 [Influenza A virus (A/Swine/Minnesota/55551/00 
(H1N2))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LC+R+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCMRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGE+SPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEVSPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACD88664.1|  nonstructural protein 1 [Influenza A virus (A/turkey/OH/313053/2004(H3N2))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAD51271.1|AF153260_1  NS1 [influenza A virus (A/Swine/North Carolina/35922/98 (H3N2))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKN++LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNA+GV
Sbjct  121  QAIMEKNLILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL87901.1|AF455709_1  nonstructural protein 1 [Influenza A virus (A/Swine/North Carolina/93523/01 
(H1N2))]
Length=219

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTEEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRV EN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVPENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL87897.1|AF455707_1  nonstructural protein 1 [Influenza A virus (A/Swine/Ohio/891/01(H1N2))]
Length=219

 Score =  427 bits (1099),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDW MLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWLMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAG01763.1|AF251408_1  nonstructural protein 1 [Influenza A virus (A/Swine/Nebraska/209/98 
(H3N2))]
Length=219

 Score =  427 bits (1099),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIMLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACE78051.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CAN04/2005(H3N2))]
 gb|ACE78053.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CAS07/2005(H3N2))]
 gb|ACE78055.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CAS09/2006(H3N2))]
Length=219

 Score =  427 bits (1098),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLE LILLRAFTEEGAIVGEISPLPSLPGHT EDVKNA+GV
Sbjct  121  QAIMEKNIILKANFSVIFNRLEILILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAIGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL29792.1|  nonstructural protein [Influenza A virus (A/SW/MN/3327/00(H1N2))]
Length=219

 Score =  427 bits (1098),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEE SETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEEPSETLKMTIASVPTSRYLTDMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABQ41893.1|  nonstructural protein 1 [Influenza A virus (A/turkey/Illinois/2004(H3N2))]
 gb|ABQ41903.1|  nonstructural protein 1 [Influenza A virus (A/swine/North Carolina/2003(H3N2))]
Length=219

 Score =  427 bits (1098),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRK+FADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKQFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKE+SSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEKSSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACD35877.1|  nonstructural protein 1 [Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2))]
 gb|ACD88653.1|  nonstructural protein 1 [Influenza A virus (A/turkey/NC/353568/2005(H3N2))]
Length=219

 Score =  427 bits (1097),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETL+LLRAFTEEGAIVGE+SPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLVLLRAFTEEGAIVGEVSPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL87899.1|AF455708_1  nonstructural protein 1 [Influenza A virus (A/Swine/North Carolina/98225/01(H1N2))]
Length=219

 Score =  427 bits (1097),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 207/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIM KNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMGKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABG34250.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/S5/2005(H1N2))]
Length=219

 Score =  427 bits (1097),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTS YL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSHYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFN+LETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNQLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACE78029.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CAS08/2005(H1N1))]
Length=219

 Score =  427 bits (1097),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT +DVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNKDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRF WRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFTWRNRNEDGRPSLPPEQK  219


>gb|AAV80805.1|  nonstructural protein 1 [Influenza A virus (A/turkey/North Carolina/12344/03(H3N2))]
Length=219

 Score =  426 bits (1096),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQ+IIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQRIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI EKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAITEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABF17984.1|  nonstructural protein 1 [Influenza A virus (A/Ontario/RV1273/2005(H3N2))]
 gb|ABF17986.1|  nonstructural protein 1 [Influenza A virus (A/swine/Alberta/14722/2005(H3N2))]
 gb|ABF17990.1|  nonstructural protein 1 [Influenza A virus (A/swine/Manitoba/12707/2005(H3N2))]
 gb|ABF17992.1|  nonstructural protein 1 [Influenza A virus (A/swine/Ontario/33853/2005(H3N2))]
 gb|ABF17994.1|  nonstructural protein 1 [Influenza A virus (A/turkey/Ontario/31232/2005(H3N2))]
 gb|ACF04397.1|  nonstructural protein 1 [Influenza A virus (A/swine/Quebec/4001/2005(H3N2))]
Length=219

 Score =  426 bits (1096),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACF25591.1|  nonstructural protein 1 [Influenza A virus (A/turkey/IA/21089-3/1992(H1N1))]
Length=219

 Score =  426 bits (1096),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAN46831.1|  nonstructural protein [Influenza A virus (A/Swine/Korea/CY02/02(H1N2))]
Length=219

 Score =  426 bits (1095),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIET TLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETVTLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL29791.1|  nonstructural protein [Influenza A virus (A/SW/MN/12883/00(H1N2))]
Length=219

 Score =  426 bits (1095),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKN +LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNTILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABC59713.1|  nonstructural protein [Influenza A virus (A/turkey/Ohio/313053/04(H3N2))]
Length=219

 Score =  426 bits (1095),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+IGPLC R+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKVIGPLCARMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABA46963.1|  NS1 [Influenza A virus (A/swine/Minnesota/00395/2004(H3N1))]
Length=219

 Score =  426 bits (1095),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNA+GV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAIGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRF WRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFTWRNRNEDGRPSLPPEQK  219


>gb|AAL29793.1|  nonstructural protein [Influenza A virus (A/SW/MN/22860-T/01(H1N2))]
 gb|AAL29794.1|  nonstructural protein [Influenza A virus (A/SW/MN/22860-S/01(H1N2))]
Length=219

 Score =  426 bits (1094),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKII  LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIISSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF RLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFTRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAG01772.1|AF251416_1  nonstructural protein 1 [Influenza A virus (A/Swine/Iowa/533/99 
(H3N2))]
 gb|AAG01790.1|AF251432_1  nonstructural protein 1 [Influenza A virus (A/Swine/Minnesota/593/99 
(H3N2))]
 gb|AAL29812.1|  nonstructural protein [Influenza A virus (A/SW/NC/45319/99(H1N2))]
Length=219

 Score =  426 bits (1094),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 206/219 (94%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIMLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ABF17988.1|  nonstructural protein 1 [Influenza A virus (A/swine/British Columbia/28103/2005(H3N2))]
Length=219

 Score =  425 bits (1092),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLE LILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLEALILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAO92928.1|  nonstructural protein 1 [Influenza A virus (A/Chicken/NY/21665-73/98(H7N2))]
Length=219

 Score =  425 bits (1092),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MT ASVPTSRYL+D+TLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTTASVPTSRYLADITLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVS+N+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSKNLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAC36140.1|  nonstructural protein [Influenza A virus (A/swine/Iowa/17672/1988(H1N1))]
 gb|ABR29600.1|  nonstructural protein 1 [Influenza A virus (A/swine/Iowa/17672/1988(H1N1))]
 gb|ABW71526.1|  nonstructural protein 1 [Influenza A virus (A/swine/Iowa/24297/1991(H1N1))]
Length=219

 Score =  424 bits (1091),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAL87909.1|AF455713_1  nonstructural protein 1 [Influenza A virus (A/Swine/Illinois/100085A/01 
(H1N2))]
 gb|AAL87911.1|AF455714_1  nonstructural protein 1 [Influenza A virus (A/Swine/Illinois/100084/01 
(H1N2))]
Length=219

 Score =  424 bits (1091),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDW MLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWLMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFN+LETLILLRAFTE+GAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNQLETLILLRAFTEQGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+G+PSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGKPSLPPEQK  219


>gb|AAV80808.1|  nonstructural protein 1 [Influenza A virus (A/turkey/Minnesota/764-2/03(H3N2))]
Length=219

 Score =  424 bits (1091),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQ+IIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQRIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI EKNI+LKANFSVIFNRLETLILLRAFTEEGA VGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAITEKNIILKANFSVIFNRLETLILLRAFTEEGASVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABA27436.1|  nonstructural protein [Influenza A virus (A/swine/MI/PU243/04 
(H3N1))]
Length=219

 Score =  424 bits (1090),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTS YL+DMTLEEMSRDWFMLMPRQKIIGPLCV++D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSSYLADMTLEEMSRDWFMLMPRQKIIGPLCVQMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACD88708.1|  nonstructural protein 1 [Influenza A virus (A/turkey/NC/19762/1988(H1N1))]
Length=219

 Score =  424 bits (1090),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATL+
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLI  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ABG34257.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/S11/2005(H1N2))]
Length=219

 Score =  424 bits (1090),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTS YL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSHYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANF VIFN+LETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFIVIFNQLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABR29570.1|  nonstructural protein 1 [Influenza A virus (A/swine/Maryland/23239/1991(H1N1))]
Length=219

 Score =  424 bits (1090),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRV EN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVPENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACF25601.1|  nonstructural protein 1 [Influenza A virus (A/turkey/IA/10271-3/1990(H1N1))]
Length=219

 Score =  424 bits (1089),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMT+EEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTIEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ACD65215.1|  nonstructural protein 1 [Influenza A virus (A/swine/Ohio/24366/07(H1N1))]
Length=217

 Score =  424 bits (1089),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)

Query  3    SNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGK  62
            SNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGK
Sbjct  1    SNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGK  60

Query  63   QIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQA  122
            QIVEWIL+EESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGP CV++DQA
Sbjct  61   QIVEWILREESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPFCVQMDQA  120

Query  123  IMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLI  182
            IMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGVLI
Sbjct  121  IMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGVLI  180

Query  183  GGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            GGLEWNGNTVR SEN+QRFAWRN +ENGRPSLPPEQK
Sbjct  181  GGLEWNGNTVRGSENLQRFAWRNRNENGRPSLPPEQK  217


>gb|AAL29811.1|  nonstructural protein [Influenza A virus (A/SW/OH/7802/00(H1N2))]
Length=219

 Score =  424 bits (1089),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKR ADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRLADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIMLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAL29807.1|  nonstructural protein [Influenza A virus (A/SW/NE/21147/01(H1N2))]
 gb|AAL29808.1|  nonstructural protein [Influenza A virus (A/SW/MN/34893/01(H1N2))]
 gb|AAL29809.1|  nonstructural protein [Influenza A virus (A/SW/NE/18339/01(H1N2))]
 gb|AAL29810.1|  nonstructural protein [Influenza A virus (A/SW/MN/13130/00(H1N2))]
Length=219

 Score =  423 bits (1088),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDC LWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCSLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MT ASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTNASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            L+GGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LVGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL29795.1|  nonstructural protein [Influenza A virus (A/SW/MN/3128/00(H1N2))]
Length=219

 Score =  423 bits (1088),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QA+MEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAMMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GR  LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRSPLPPEQK  219


>gb|ACE78027.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CAN01/2004(H1N1))]
Length=219

 Score =  423 bits (1088),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHI KRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIPKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT +DVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNKDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRF WRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFTWRNRNEDGRPSLPPEQK  219


>gb|AAO88260.1|  nonstructural protein 1 [Influenza A virus (A/Wisconsin/10/98 
(H1N1))]
Length=219

 Score =  423 bits (1088),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDS T+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSTTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+ MTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLAGMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI+EKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAILEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABY81725.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/JNS06/2004(H3N2))]
Length=219

 Score =  423 bits (1088),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFA+NGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFANNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWR+ +EN RPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSEDLQRFAWRSRNENERPSLPPEQK  219


>gb|ACD35870.1|  nonstructural protein 1 [Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2))]
 gb|ACF25537.1|  nonstructural protein 1 [Influenza A virus (A/turkey/MN/366767/2005(H3N2))]
Length=219

 Score =  423 bits (1088),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRK FADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKLFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAL29790.1|  nonstructural protein [Influenza A virus (A/SW/AR/12491/00(H1N2))]
Length=219

 Score =  423 bits (1088),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKG GNTLGLD ETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGSGNTLGLDTETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+IG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKMIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACI41027.1|  nonstructural protein 1 [Influenza A virus (A/turkey/NC/17026/1988(H1N1))]
Length=219

 Score =  423 bits (1087),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATL+
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLI  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMP+QKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPKQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAL29796.1|  nonstructural protein [Influenza A virus (A/SW/KS/13481-T/00(H1N2))]
 gb|AAL29797.1|  nonstructural protein [Influenza A virus (A/SW/KS/13481-S/00(H1N2))]
Length=219

 Score =  423 bits (1087),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT E+VKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDENVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGG EWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGPEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACE78031.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2))]
 gb|ACE78033.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/JL01/2005(H1N2))]
 gb|ACE78037.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/JL04/2005(H1N2))]
 gb|ACE78039.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/Asan04/2006(H1N2))]
Length=219

 Score =  422 bits (1086),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI EKNI+LKANFSVIFNRLE LILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVG 
Sbjct  121  QAITEKNIILKANFSVIFNRLENLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGA  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAU25874.1|  nonstructural protein 1 [Influenza A virus (A/Swine/Wisconsin/238/97(H1N1))]
Length=219

 Score =  422 bits (1086),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 205/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIME NI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMENNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRP LP EQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPPLPSEQK  219


>gb|AAL87907.1|AF455712_1  nonstructural protein 1 [Influenza A virus (A/Swine/Indiana/P12439/00 
(H1N2))]
Length=219

 Score =  422 bits (1085),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVP SRYL+DMTLEEMSRDWFMLMPRQKII  LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPNSRYLADMTLEEMSRDWFMLMPRQKIIRSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAI+GEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIIGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABR87891.1|  nonstructural protein 1 [Influenza A virus (A/swine/Guangxi/13/2006(H1N2))]
Length=219

 Score =  422 bits (1085),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI+EKNI+LKANFSVIFNRLETL+LLRAFTE GAIVGEISPLPSLPGHT EDVKNAVG+
Sbjct  121  QAIIEKNIILKANFSVIFNRLETLVLLRAFTEGGAIVGEISPLPSLPGHTDEDVKNAVGI  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACI26609.1|  nonstructural protein 1 [Influenza A virus (A/swine/Memphis/1/1990(H1N1))]
Length=219

 Score =  422 bits (1084),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEE +ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEEFNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ABI19009.1|  nonstructural protein 1 [Influenza A virus (A/Iowa/CEID23/2005(H1N1))]
Length=219

 Score =  422 bits (1084),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDS T+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSTTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSR+WFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRNWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSV+FNRLETLILLRAFTEEG +VGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVVFNRLETLILLRAFTEEGTVVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABR29590.1|  nonstructural protein 1 [Influenza A virus (A/swine/Wisconsin/1915/1988(H1N1))]
Length=219

 Score =  422 bits (1084),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKE+S+ETL+M IASVPTSRYL+DM LEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEDSNETLKMAIASVPTSRYLADMALEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +ENGRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNENGRPSLPPEQK  219


>gb|AAB51007.1|  nonstructural protein NS1 [Influenza A virus (A/swine/Hong Kong/273/1994(H1N1))]
Length=218

 Score =  421 bits (1083),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/218 (93%), Positives = 215/218 (98%), Gaps = 0/218 (0%)

Query  2    DSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVG  61
            DSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+T+GLDIETATLVG
Sbjct  1    DSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTIGLDIETATLVG  60

Query  62   KQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQ  121
            KQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+DQ
Sbjct  61   KQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMDQ  120

Query  122  AIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVL  181
            AIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGVL
Sbjct  121  AIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGVL  180

Query  182  IGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            IGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  IGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  218


>gb|AAU25872.1|  nonstructural protein 1 [Influenza A virus (A/Swine/Wisconsin/458/98(H1N1))]
 gb|ABB86952.1|  nonstructural protein 1 [Influenza A virus (A/swine/Wisconsin/464/98(H1N1))]
Length=219

 Score =  421 bits (1083),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 216/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWF+LMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFILMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFT+EGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTKEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAL29800.1|  nonstructural protein [Influenza A virus (A/SW/MN/16356/01(H1N2))]
Length=219

 Score =  421 bits (1083),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSE L+MTIAS+PTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSEILKMTIASIPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPS PPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSPPPEQK  219


>gb|AAL29804.1|  nonstructural protein [Influenza A virus (A/SW/CO/17871/01(H1N2))]
Length=219

 Score =  421 bits (1082),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPF+DRLRRDQKSLKGRGNTLG+DIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFIDRLRRDQKSLKGRGNTLGIDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+D+TLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADITLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIM KNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMGKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +E+GRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNEDGRPSLSPEQK  219


>gb|AAB03300.1|  NS [Influenza A virus (A/WI/4755/1994(H1N1))]
Length=219

 Score =  421 bits (1082),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+M IASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMAIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ACI48766.1|  nonstructural protein 1 [Influenza A virus (A/swine/Shanghai/1/2007(H1N2))]
Length=219

 Score =  421 bits (1082),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRK+FADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKQFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI+EKNI+LKANFSVIFNRLETL+LLRAFTE GAIVGEISPLPSLPGHT EDVKNAVG+
Sbjct  121  QAIIEKNIILKANFSVIFNRLETLVLLRAFTEGGAIVGEISPLPSLPGHTDEDVKNAVGI  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACF04387.1|  nonstructural protein 1 [Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2))]
Length=219

 Score =  421 bits (1081),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWN NTVR SEN+QRFAWRN +E+GR SLPPEQK
Sbjct  181  LIGGLEWNDNTVRGSENLQRFAWRNRNEDGRSSLPPEQK  219


>gb|ACE78035.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/JL02/2005(H1N2))]
 gb|ACE78041.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/PZ4/2006(H1N2))]
 gb|ACE78043.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/PZ7/2006(H1N2))]
 gb|ACE78045.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/PZ14/2006(H1N2))]
 gb|ACE78047.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CY08/2007(H1N2))]
Length=219

 Score =  421 bits (1081),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 204/219 (93%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKR ADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRVADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI EKNI+LKANFSVIFNRLE LILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAITEKNIILKANFSVIFNRLENLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLSPEQK  219


>gb|AAO65608.1|  nonstructural protein 1 [Influenza A virus (A/duck/NC/91347/01(H1N2))]
Length=219

 Score =  420 bits (1080),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFAD+GLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATL 
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADDGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLA  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIM KNI+LKANFSVIFNRLETL+LLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMGKNIILKANFSVIFNRLETLVLLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR+SE++QRFAWRN +E GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRISEDLQRFAWRNRNEGGRPSLPPEQK  219


>gb|ACK99415.1|  nonstructural protein 1 [Influenza A virus (A/swine/Wisconsin/30954/1976(H1N1))]
Length=219

 Score =  419 bits (1078),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATL 
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLA  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVP+SRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPSSRYLADMTLEEMSRDWFMLMPRQKVAGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+C+ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSCNENGRPPLPPEQK  219


>gb|ABY84689.1|  nonstructural protein 1 [Influenza A virus (A/swine/California/T9001707/1991(H1N1))]
Length=219

 Score =  419 bits (1078),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEE +ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEEFNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLSPEQK  219


>gb|AAR90878.1|  nonstructural protein [Influenza A virus (A/swine/Pingtung/7-12/1999(H1N2))]
Length=219

 Score =  419 bits (1077),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFAD+GLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADSGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVRLD
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRLD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFN+LETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNQLETLILLRAFTEEGAIVGEISPLLSLPGHTGEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+C+ENGRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSCNENGRPSLSPEQK  219


>gb|AAL29802.1|  nonstructural protein [Influenza A virus (A/SW/MN/17138/01(H1N2))]
Length=219

 Score =  419 bits (1076),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSE L+MTIAS+PTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSEILKMTIASIPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVK AVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKIAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWN NTVR SEN+QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNSNTVRGSENLQRFAWRNRNEDGRPSLPPEQK  219


>gb|AAB50997.1|  nonstructural protein NS1 [Influenza A virus (A/swine/Iowa/17672/1988(H1N1))]
Length=216

 Score =  419 bits (1076),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 202/216 (93%), Positives = 213/216 (98%), Gaps = 0/216 (0%)

Query  4    NTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLVGKQ  63
            NT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGLDIETATLVGKQ
Sbjct  1    NTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLDIETATLVGKQ  60

Query  64   IVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLDQAI  123
            IVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+DQAI
Sbjct  61   IVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMDQAI  120

Query  124  MEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGVLIG  183
            MEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGVLIG
Sbjct  121  MEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGVLIG  180

Query  184  GLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            GLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  GLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  216


>gb|ABY70962.1|  nonstructural protein 1 [Influenza A virus (A/Ontario/1252/2007(H3N2))]
Length=219

 Score =  418 bits (1075),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTL LDI TATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLSLDIGTATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSV+FNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVVFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRF WRN +E+GRPSLP EQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFTWRNRNEDGRPSLPSEQK  219


>gb|AAB03299.1|  NS [Influenza A virus (A/WI/4754/1994(H1N1))]
Length=219

 Score =  418 bits (1075),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLG DIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGPDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+M IASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMAIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAL29803.1|  nonstructural protein [Influenza A virus (A/SW/NC/17366/01(H1N2))]
Length=219

 Score =  418 bits (1074),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGD PFLDRLRRDQKSLKGRG TLGLDI+TATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDVPFLDRLRRDQKSLKGRGTTLGLDIKTATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGE+SPLPSLPGHT ED+KNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEVSPLPSLPGHTDEDIKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GR SLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRSSLPPEQK  219


>gb|ABY40427.1|  nonstructural protein 1 [Influenza A virus (A/swine/Missouri/2124514/2006(H2N3))]
Length=219

 Score =  417 bits (1073),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 201/219 (91%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDS T+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSTTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEEMSRDW MLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEMSRDWLMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEG IVGEIS LPSLPGHT EDVKNA+GV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGTIVGEISQLPSLPGHTNEDVKNAIGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPE+K
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEKK  219


>gb|AAG01781.1|AF251424_1  nonstructural protein 1 [Influenza A virus (A/Swine/Iowa/569/99 
(H3N2))]
Length=219

 Score =  417 bits (1072),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDS  + SFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSPLVPSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIMLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ACF17154.1|  nonstructural protein 1 [Influenza A virus (A/swine/Hainan/1/2005(H1N2))]
Length=219

 Score =  417 bits (1072),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRK+FADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIE ATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKQFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIEKATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWF+LMPRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFILMPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI+EKNI+LKANFSVIFNRLETL+LLRAFTE GAIVGEISPLPSLPGHT EDVKNAVG+
Sbjct  121  QAIIEKNIILKANFSVIFNRLETLVLLRAFTEGGAIVGEISPLPSLPGHTDEDVKNAVGI  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ACE78061.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CY07/2007(H3N2))]
Length=219

 Score =  417 bits (1071),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 210/219 (95%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGITLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSET +M IASVPTSRYL+DMTLEEMSRDWFMLMPRQK IG LCVR+D
Sbjct  61   GKQIVEWILKEESSETHKMIIASVPTSRYLADMTLEEMSRDWFMLMPRQKTIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKN++LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAV V
Sbjct  121  QAIMEKNVILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVEV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +ENGRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRSSENLQRFAWRNRNENGRPSLPPEQK  219


>gb|ACF17149.1|  nonstructural protein 1 [Influenza A virus (A/swine/Guangxi/17/2005(H1N2))]
Length=219

 Score =  417 bits (1071),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 215/219 (98%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRK+FADNGLGDAPFLDRLRRD+KSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKQFADNGLGDAPFLDRLRRDRKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+MTIASVPTSRYL+DMTLEEMSRDWFML+PRQKIIG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMTIASVPTSRYLADMTLEEMSRDWFMLVPRQKIIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAI+EKNI+LKANFSVIFNRLETL+LLRAFTE GAIVGEISPLPSLPGHT EDVKNAVG+
Sbjct  121  QAIIEKNIILKANFSVIFNRLETLVLLRAFTEGGAIVGEISPLPSLPGHTGEDVKNAVGI  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QRFAWRN +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRFAWRNRNEDGRPSLPPEQK  219


>gb|ABR28663.1|  nonstructural protein 1 [Influenza A virus (A/swine/Ontario/4/1981(H1N1))]
 gb|ABR28674.1|  nonstructural protein 1 [Influenza A virus (A/swine/Ontario/7/1981(H1N1))]
 gb|ABR28718.1|  nonstructural protein 1 [Influenza A virus (A/swine/Wisconsin/11/1980(H1N1))]
 gb|ABW36338.1|  nonstructural protein 1 [Influenza A virus (A/swine/Ontario/2/1981(H1N1))]
 gb|ABW36349.1|  nonstructural protein 1 [Influenza A virus (A/swine/Ontario/3/1981(H1N1))]
Length=219

 Score =  416 bits (1070),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 201/219 (91%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKMTGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|ABQ45419.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/3/1976(H1N1))]
 gb|ABQ45430.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/7/1976(H1N1))]
 gb|ABW36371.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/10/1976(H1N1))]
Length=219

 Score =  416 bits (1070),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 199/219 (90%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATL 
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLA  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVP+SRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPSSRYLADMTLEEMSRDWFMLMPRQKVAGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+C+ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSCNENGRPPLPPEQK  219


>gb|ACE78065.1|  nonstructural protein 1 [Influenza A virus (A/swine/Korea/CY10/2007(H3N2))]
Length=219

 Score =  416 bits (1070),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 210/219 (95%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG TLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGITLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSETL+M IASVPTSRYL+DMTLEEMSRDWFMLMPRQK IG LCVR+D
Sbjct  61   GKQIVEWILKEESSETLKMIIASVPTSRYLADMTLEEMSRDWFMLMPRQKTIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKN++LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAV V
Sbjct  121  QAIMEKNVILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVEV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR  EN+QRFAWRN +ENGRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRSFENLQRFAWRNRNENGRPSLPPEQK  219


>gb|ABY40442.1|  nonstructural protein 1 [Influenza A virus (A/swine/Missouri/4296424/2006(H2N3))]
Length=219

 Score =  416 bits (1068),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDS T+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSTTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESS+TL+MTIASVPTSRYL+DMTLEE+SRDW MLMPRQKIIGPLCVR+D
Sbjct  61   GKQIVEWILKEESSDTLKMTIASVPTSRYLADMTLEEISRDWLMLMPRQKIIGPLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEG IVGEIS LPSLPGHT EDVKNA+GV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGTIVGEISQLPSLPGHTNEDVKNAIGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPSLPPE+K
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSLPPEKK  219


>gb|ABL75553.1|  NS1 protein [Influenza A virus (A/swine/Guangdong/3/2005(H1N1))]
Length=219

 Score =  416 bits (1068),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNTMSSFQVDCF+WHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+T+GLDIETATLV
Sbjct  1    MDSNTMSSFQVDCFIWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTIGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPR K+IG L +R+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRGKMIGSLYLRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAZ79396.1|  nonstructural protein 1 [Influenza A virus (A/swine/Zhejiang/1/2004(H1N2))]
Length=219

 Score =  416 bits (1068),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTS YL+DMTLEEMSRDWFMLMPRQKIIG LC+R+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSHYLADMTLEEMSRDWFMLMPRQKIIGSLCMRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QA MEKNI+LKANFSV+FNRLETLILLRAF+EEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QATMEKNIILKANFSVVFNRLETLILLRAFSEEGAIVGEISPLPSLPGHTEEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWN NTVRVSEN+QRFAWR  +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNDNTVRVSENLQRFAWRIRNEDGRPSLPPEQK  219


>gb|AAL29789.1|  nonstructural protein [Influenza A virus (A/SW/MO/18777/01(H1N2))]
Length=219

 Score =  415 bits (1066),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 201/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEESSE L+MTIAS+PTSRYL+DMTLEEMSRDWFMLMPRQKII  LCVR+ 
Sbjct  61   GKQIVEWILKEESSEILKMTIASIPTSRYLADMTLEEMSRDWFMLMPRQKIISSLCVRMG  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRL+TLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLKTLILLRAFTEEGAIVGEISPLPSLPGHTNEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVR SEN+QRFAWRN +E+GRPS PPEQK
Sbjct  181  LIGGLEWNGNTVRGSENLQRFAWRNRNEDGRPSPPPEQK  219


>gb|ABS50126.1|  nonstructural protein 1 [Influenza A virus (A/swine/Iowa/31483/1988(H1N1))]
Length=219

 Score =  414 bits (1065),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+M+IASVPTSRYL+DM+LEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMSIASVPTSRYLADMSLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +ENGRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNENGRPSLSPEQK  219


>gb|ABY51209.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/4/1978(H1N1))]
Length=219

 Score =  414 bits (1065),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKVTGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNENGRPPLPPEQK  219


>gb|ABR28586.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/82/1977(H1N1))]
 gb|ABU80226.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/84/1977(H1N1))]
 gb|ABU80248.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/87/1977(H1N1))]
 gb|ABU80259.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/88/1977(H1N1))]
Length=219

 Score =  414 bits (1065),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKVAGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNENGRPPLPPEQK  219


>gb|ABW86579.1|  nonstructural protein 1 [Influenza A virus (A/swine/Tennessee/5/1978(H1N1))]
Length=219

 Score =  414 bits (1065),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKVAGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPL SLPGHT EDV+NAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVENAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWRN +ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRNRNENGRPPLPPEQK  219


>gb|ABR29580.1|  nonstructural protein 1 [Influenza A virus (A/swine/Kansas/3228/1987(H1N1))]
 gb|ABU80425.1|  nonstructural protein 1 [Influenza A virus (A/swine/Kansas/3024/1987(H1N1))]
Length=219

 Score =  414 bits (1065),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DM+LEEMSRDWFMLMPRQKI G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMSLEEMSRDWFMLMPRQKITGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSL PEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLSPEQK  219


>gb|ACD88697.1|  nonstructural protein 1 [Influenza A virus (A/chicken/PA/35154/1991(H1N1))]
Length=219

 Score =  414 bits (1065),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRQKVTGSLCVRID  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNENGRPPLPPEQK  219


>dbj|BAH02166.1|  nonstructural protein 1 [Influenza A virus (A/swine/Niigata/1/1977(H1N1))]
Length=219

 Score =  414 bits (1064),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 213/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATL 
Sbjct  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLA  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVP+SRYL+DMTLEEMSRDWFMLMPRQK++G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPSSRYLADMTLEEMSRDWFMLMPRQKVVGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILL+AFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLKAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +ENGRP LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNENGRPPLPPEQK  219


>gb|ABQ45463.1|  nonstructural protein 1 [Influenza A virus (A/swine/Iowa/1/1976(H1N1))]
Length=219

 Score =  414 bits (1064),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (96%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+TLGL+IETATL 
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTLGLNIETATLA  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVP+SRYL+DMTLEEMSRDWFMLMPRQK+ G LCVR+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPSSRYLADMTLEEMSRDWFMLMPRQKVAGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIF+RLETLILLRAFTEEGAIVGEISPL SLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLLSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+C+ENGR  LPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSCNENGRSPLPPEQK  219


>gb|ABR22245.1|  nonstructural protein 1 [Influenza A virus (A/Swine/Guangdong/01/2005(H3N2))]
Length=219

 Score =  414 bits (1063),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 199/219 (90%), Positives = 214/219 (97%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCF+WHIRKRFADNGLGDAPFLDRLRRDQKSLKGRG+T+GLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFIWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGSTIGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILKEES+ETL+MTIASVPTSRYL+DMTLEEMSRDWFMLMPR K+IG L +R+D
Sbjct  61   GKQIVEWILKEESNETLKMTIASVPTSRYLADMTLEEMSRDWFMLMPRGKMIGSLYLRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHT EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSEN+QRFAWR+ +E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSENLQRFAWRSRNEDGRPSLPPEQK  219


>gb|AAL29801.1|  nonstructural protein [Influenza A virus (A/SW/MN/16419/01(H1N2))]
Length=219

 Score =  414 bits (1063),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/219 (91%), Positives = 210/219 (95%), Gaps = 0/219 (0%)

Query  1    MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60
            MDSNT+SSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV
Sbjct  1    MDSNTVSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKGRGNTLGLDIETATLV  60

Query  61   GKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFMLMPRQKIIGPLCVRLD  120
            GKQIVEWILK ESSETL+MTIASV TSRYL+DMTLEEMSRDWFMLMPRQK+IG LCVR+D
Sbjct  61   GKQIVEWILKGESSETLKMTIASVHTSRYLADMTLEEMSRDWFMLMPRQKVIGSLCVRMD  120

Query  121  QAIMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVKNAVGV  180
            QAIMEKNI+LKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGH  EDVKNAVGV
Sbjct  121  QAIMEKNIILKANFSVIFNRLETLILLRAFTEEGAIVGEISPLPSLPGHIDEDVKNAVGV  180

Query  181  LIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQK  219
            LIGGLEWNGNTVRVSE++QR  WRN  E+GRPSLPPEQK
Sbjct  181  LIGGLEWNGNTVRVSESLQRSTWRNRTEDGRPSLPPEQK  219


NS2 Protein Structural Homolgy Model

NS2 Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 NS2, residues 64-116, 94% sequence identity to pdp template 1pd3

NS2 Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
NS2 E63K 229783374_A/Korea/01/2009 1
NS2 E67K 229598887_A/Texas/15/2009 1
NS2 A89E 228017754_A/California/06/2 3
NS2 A115T 229892755_A/Canada-NS/RV153 1

NS2 Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of NS2 Protein, 53 sequences

gi|229299513_A/Texas/05/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229368685_A/Denmark/513/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227831790_A/Texas/05/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229299533_A/Texas/04/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227977168_A/California/07/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227977144_A/California/07/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227977112_A/California/04/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227809840_A/California/04/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227977156_A/California/08/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|227977124_A/California/08/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396499_A/Ohio/07/2009         MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229536008_A/Kansas/03/2009       MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396476_A/New_York/19/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396461_A/Texas/06/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396401_A/New_York/31/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396412_A/New_York/23/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396386_A/New_York/18/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396448_A/New_York/15/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396350_A/New_York/12/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396372_A/New_York/11/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396432_A/New_York/10/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229396362_A/New_York/06/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229484057_A/Mexico/InDRE448      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229484060_A/Canada-ON/RV152      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229484055_A/Canada-NS/RV153      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229462704_A/Valencia/GP4/20      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229462716_A/Pais_Vasco/GP20      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229462728_A/Castilla-La_Man      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229462692_A/Castilla-La_Man      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229535810_A/Texas/09/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229535992_A/South_Carolina/      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229536032_A/Minnesota/02/20      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229536116_A/Michigan/02/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229535828_A/California/14/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229536017_A/Arizona/01/2009      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229783408_A/New_York/1682/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229783387_A/New_York/1669/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229892757_A/Mexico/InDRE411      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229892760_A/Canada-ON/RV152      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229892769_A/Canada-ON/RV152      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229892766_A/Canada-NS/RV153      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229892763_A/Canada-AB/RV153      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|237511857_A/Mexico/4604/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|237511866_A/Mexico/4603/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|237511860_A/Mexico/4486/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|237511872_A/Mexico/4115/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|237511869_A/Mexico/4108/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229783374_A/Korea/01/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229892755_A/Canada-NS/RV153      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229598887_A/Texas/15/2009        MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|228017754_A/California/06/2      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|229536106_A/Nebraska/02/200      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
gi|237624336_A/swine/Alberta/O      MDSNTMSSFQDILMRMSKMQLGSSSEDLNGMVTRFESLKIYRDSLGETVM 50
                                    **************************************************

gi|229299513_A/Texas/05/2009        RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229368685_A/Denmark/513/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227831790_A/Texas/05/2009        RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229299533_A/Texas/04/2009        RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227977168_A/California/07/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227977144_A/California/07/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227977112_A/California/04/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227809840_A/California/04/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227977156_A/California/08/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|227977124_A/California/08/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396499_A/Ohio/07/2009         RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229536008_A/Kansas/03/2009       RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396476_A/New_York/19/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396461_A/Texas/06/2009        RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396401_A/New_York/31/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396412_A/New_York/23/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396386_A/New_York/18/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396448_A/New_York/15/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396350_A/New_York/12/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396372_A/New_York/11/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396432_A/New_York/10/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229396362_A/New_York/06/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229484057_A/Mexico/InDRE448      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229484060_A/Canada-ON/RV152      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229484055_A/Canada-NS/RV153      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229462704_A/Valencia/GP4/20      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229462716_A/Pais_Vasco/GP20      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229462728_A/Castilla-La_Man      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229462692_A/Castilla-La_Man      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229535810_A/Texas/09/2009        RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229535992_A/South_Carolina/      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229536032_A/Minnesota/02/20      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229536116_A/Michigan/02/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229535828_A/California/14/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229536017_A/Arizona/01/2009      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229783408_A/New_York/1682/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229783387_A/New_York/1669/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229892757_A/Mexico/InDRE411      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229892760_A/Canada-ON/RV152      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229892769_A/Canada-ON/RV152      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229892766_A/Canada-NS/RV153      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229892763_A/Canada-AB/RV153      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|237511857_A/Mexico/4604/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|237511866_A/Mexico/4603/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|237511860_A/Mexico/4486/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|237511872_A/Mexico/4115/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|237511869_A/Mexico/4108/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229783374_A/Korea/01/2009        RMGDLHYLQSRNKKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229892755_A/Canada-NS/RV153      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|229598887_A/Texas/15/2009        RMGDLHYLQSRNEKWRKQLGQKFEEIRWLIEEMRHRLKATENSFEQITFM 100
gi|228017754_A/California/06/2      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKETENSFEQITFM 100
gi|229536106_A/Nebraska/02/200      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKETENSFEQITFM 100
gi|237624336_A/swine/Alberta/O      RMGDLHYLQSRNEKWREQLGQKFEEIRWLIEEMRHRLKETENSFEQITFM 100
                                    ************:***:********************* ***********

gi|229299513_A/Texas/05/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|229368685_A/Denmark/513/200      QALQLLLEVEQEIRAFS---- 117
gi|227831790_A/Texas/05/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|229299533_A/Texas/04/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|227977168_A/California/07/2      QALQLLLEVEQEIRAFSFQLI 121
gi|227977144_A/California/07/2      QALQLLLEVEQEIRAFSFQLI 121
gi|227977112_A/California/04/2      QALQLLLEVEQEIRAFSFQLI 121
gi|227809840_A/California/04/2      QALQLLLEVEQEIRAFSFQLI 121
gi|227977156_A/California/08/2      QALQLLLEVEQEIRAFSFQLI 121
gi|227977124_A/California/08/2      QALQLLLEVEQEIRAFSFQLI 121
gi|229396499_A/Ohio/07/2009         QALQLLLEVEQEIRAFSFQLI 121
gi|229536008_A/Kansas/03/2009       QALQLLLEVEQEIRAFSFQLI 121
gi|229396476_A/New_York/19/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396461_A/Texas/06/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|229396401_A/New_York/31/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396412_A/New_York/23/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396386_A/New_York/18/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396448_A/New_York/15/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396350_A/New_York/12/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396372_A/New_York/11/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396432_A/New_York/10/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229396362_A/New_York/06/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229484057_A/Mexico/InDRE448      QALQLLLEVEQEIRAFSFQLI 121
gi|229484060_A/Canada-ON/RV152      QALQLLLEVEQEIRAFSFQLI 121
gi|229484055_A/Canada-NS/RV153      QALQLLLEVEQEIRAFSFQLI 121
gi|229462704_A/Valencia/GP4/20      QALQLLLEVEQEIRAFSFQLI 121
gi|229462716_A/Pais_Vasco/GP20      QALQLLLEVEQEIRAFSFQLI 121
gi|229462728_A/Castilla-La_Man      QALQLLLEVEQEIRAFSFQLI 121
gi|229462692_A/Castilla-La_Man      QALQLLLEVEQEIRAFSFQLI 121
gi|229535810_A/Texas/09/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|229535992_A/South_Carolina/      QALQLLLEVEQEIRAFSFQLI 121
gi|229536032_A/Minnesota/02/20      QALQLLLEVEQEIRAFSFQLI 121
gi|229536116_A/Michigan/02/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229535828_A/California/14/2      QALQLLLEVEQEIRAFSFQLI 121
gi|229536017_A/Arizona/01/2009      QALQLLLEVEQEIRAFSFQLI 121
gi|229783408_A/New_York/1682/2      QALQLLLEVEQEIRAFSFQLI 121
gi|229783387_A/New_York/1669/2      QALQLLLEVEQEIRAFSFQLI 121
gi|229892757_A/Mexico/InDRE411      QALQLLLEVEQEIRAFSFQLI 121
gi|229892760_A/Canada-ON/RV152      QALQLLLEVEQEIRAFSFQLI 121
gi|229892769_A/Canada-ON/RV152      QALQLLLEVEQEIRAFSFQLI 121
gi|229892766_A/Canada-NS/RV153      QALQLLLEVEQEIRAFSFQLI 121
gi|229892763_A/Canada-AB/RV153      QALQLLLEVEQEIRAFSFQLI 121
gi|237511857_A/Mexico/4604/200      QALQLLLEVEQEIRAFSFQLI 121
gi|237511866_A/Mexico/4603/200      QALQLLLEVEQEIRAFSFQLI 121
gi|237511860_A/Mexico/4486/200      QALQLLLEVEQEIRAFSFQLI 121
gi|237511872_A/Mexico/4115/200      QALQLLLEVEQEIRAFSFQLI 121
gi|237511869_A/Mexico/4108/200      QALQLLLEVEQEIRAFSFQLI 121
gi|229783374_A/Korea/01/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|229892755_A/Canada-NS/RV153      QALQLLLEVEQEIRTFSFQLI 121
gi|229598887_A/Texas/15/2009        QALQLLLEVEQEIRAFSFQLI 121
gi|228017754_A/California/06/2      QALQLLLEVEQEIRAFSFQLI 121
gi|229536106_A/Nebraska/02/200      QALQLLLEVEQEIRAFSFQLI 121
gi|237624336_A/swine/Alberta/O      QALQLLLEVEQEIRAFSFQLI 121
                                    **************:**    

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools