User:Michael Strong/H1N1/PA

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

Protein Structural Homolgy Model

PA Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 PA, residues 257-716, 97% sequence identity to pdp template 3cm8

Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
PA S224P 227977170_A/California/07/2 6
PA R269K 229484063_A/Canada-NS/RV153 2
PA L275I 229484065_A/Mexico/InDRE448 all others
PA M581L 237511889_A/Mexico/4108/200 11
PA L702P 237624325_A/swine/Alberta/O 1

Multiple Sequence Alignment

gi|237511877_A/Mexico/4603/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511887_A/Mexico/4482/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229484063_A/Canada-NS/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892778_A/Canada-NS/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237624325_A/swine/Alberta/O      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831785_A/California/06/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831770_A/California/05/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229536083_A/Indiana/09/2009      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229783410_A/New_York/1682/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229783389_A/New_York/1669/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892772_A/Canada-NS/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511881_A/Mexico/4486/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511889_A/Mexico/4108/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511879_A/Mexico/4604/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892776_A/Canada-AB/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892782_A/Canada-ON/RV152      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892774_A/Canada-ON/RV152      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892780_A/Mexico/InDRE411      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229535826_A/California/14/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229536113_A/Michigan/02/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229536127_A/New_York/13/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229535979_A/Texas/08/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229535808_A/Texas/09/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229484067_A/Canada-ON/RV152      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229484065_A/Mexico/InDRE448      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396441_A/New_York/10/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396379_A/New_York/11/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396455_A/New_York/15/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396397_A/New_York/18/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396408_A/New_York/31/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396485_A/New_York/19/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396502_A/Ohio/07/2009         MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977134_A/Texas/04/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229299530_A/Texas/04/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831799_A/Texas/05/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229299510_A/Texas/05/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977170_A/California/07/2      MEDFVRQCFNPMIVELAXKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977146_A/California/07/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831815_A/California/07/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977114_A/California/04/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227809828_A/California/04/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396427_A/California/08/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
                                    ***************** ********************************

gi|237511877_A/Mexico/4603/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511887_A/Mexico/4482/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229484063_A/Canada-NS/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892778_A/Canada-NS/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237624325_A/swine/Alberta/O      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831785_A/California/06/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831770_A/California/05/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229536083_A/Indiana/09/2009      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229783410_A/New_York/1682/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229783389_A/New_York/1669/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892772_A/Canada-NS/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511881_A/Mexico/4486/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511889_A/Mexico/4108/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511879_A/Mexico/4604/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892776_A/Canada-AB/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892782_A/Canada-ON/RV152      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892774_A/Canada-ON/RV152      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892780_A/Mexico/InDRE411      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229535826_A/California/14/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229536113_A/Michigan/02/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229536127_A/New_York/13/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229535979_A/Texas/08/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229535808_A/Texas/09/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229484067_A/Canada-ON/RV152      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229484065_A/Mexico/InDRE448      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396441_A/New_York/10/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396379_A/New_York/11/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396455_A/New_York/15/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396397_A/New_York/18/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396408_A/New_York/31/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396485_A/New_York/19/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396502_A/Ohio/07/2009         FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977134_A/Texas/04/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229299530_A/Texas/04/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831799_A/Texas/05/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229299510_A/Texas/05/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977170_A/California/07/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977146_A/California/07/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831815_A/California/07/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977114_A/California/04/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227809828_A/California/04/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396427_A/California/08/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
                                    **************************************************

gi|237511877_A/Mexico/4603/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511887_A/Mexico/4482/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229484063_A/Canada-NS/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892778_A/Canada-NS/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237624325_A/swine/Alberta/O      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831785_A/California/06/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831770_A/California/05/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229536083_A/Indiana/09/2009      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229783410_A/New_York/1682/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229783389_A/New_York/1669/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892772_A/Canada-NS/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511881_A/Mexico/4486/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511889_A/Mexico/4108/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511879_A/Mexico/4604/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892776_A/Canada-AB/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892782_A/Canada-ON/RV152      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892774_A/Canada-ON/RV152      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892780_A/Mexico/InDRE411      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229535826_A/California/14/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229536113_A/Michigan/02/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229536127_A/New_York/13/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229535979_A/Texas/08/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229535808_A/Texas/09/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229484067_A/Canada-ON/RV152      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229484065_A/Mexico/InDRE448      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396441_A/New_York/10/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396379_A/New_York/11/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396455_A/New_York/15/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396397_A/New_York/18/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396408_A/New_York/31/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396485_A/New_York/19/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396502_A/Ohio/07/2009         EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977134_A/Texas/04/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229299530_A/Texas/04/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831799_A/Texas/05/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229299510_A/Texas/05/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977170_A/California/07/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977146_A/California/07/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831815_A/California/07/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977114_A/California/04/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227809828_A/California/04/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396427_A/California/08/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
                                    **************************************************

gi|237511877_A/Mexico/4603/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511887_A/Mexico/4482/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229484063_A/Canada-NS/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892778_A/Canada-NS/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237624325_A/swine/Alberta/O      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831785_A/California/06/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831770_A/California/05/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229536083_A/Indiana/09/2009      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229783410_A/New_York/1682/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229783389_A/New_York/1669/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892772_A/Canada-NS/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511881_A/Mexico/4486/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511889_A/Mexico/4108/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511879_A/Mexico/4604/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892776_A/Canada-AB/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892782_A/Canada-ON/RV152      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892774_A/Canada-ON/RV152      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892780_A/Mexico/InDRE411      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229535826_A/California/14/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229536113_A/Michigan/02/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229536127_A/New_York/13/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229535979_A/Texas/08/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229535808_A/Texas/09/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229484067_A/Canada-ON/RV152      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229484065_A/Mexico/InDRE448      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396441_A/New_York/10/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396379_A/New_York/11/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396455_A/New_York/15/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396397_A/New_York/18/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396408_A/New_York/31/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396485_A/New_York/19/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396502_A/Ohio/07/2009         TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977134_A/Texas/04/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229299530_A/Texas/04/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831799_A/Texas/05/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229299510_A/Texas/05/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977170_A/California/07/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977146_A/California/07/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831815_A/California/07/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977114_A/California/04/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227809828_A/California/04/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396427_A/California/08/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
                                    **************************************************

gi|237511877_A/Mexico/4603/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511887_A/Mexico/4482/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229484063_A/Canada-NS/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892778_A/Canada-NS/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237624325_A/swine/Alberta/O      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831785_A/California/06/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831770_A/California/05/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229536083_A/Indiana/09/2009      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229783410_A/New_York/1682/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229783389_A/New_York/1669/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892772_A/Canada-NS/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511881_A/Mexico/4486/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511889_A/Mexico/4108/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511879_A/Mexico/4604/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892776_A/Canada-AB/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892782_A/Canada-ON/RV152      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892774_A/Canada-ON/RV152      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892780_A/Mexico/InDRE411      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229535826_A/California/14/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229536113_A/Michigan/02/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229536127_A/New_York/13/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229535979_A/Texas/08/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229535808_A/Texas/09/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229484067_A/Canada-ON/RV152      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229484065_A/Mexico/InDRE448      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396441_A/New_York/10/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396379_A/New_York/11/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396455_A/New_York/15/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396397_A/New_York/18/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396408_A/New_York/31/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396485_A/New_York/19/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396502_A/Ohio/07/2009         IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977134_A/Texas/04/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229299530_A/Texas/04/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831799_A/Texas/05/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229299510_A/Texas/05/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977170_A/California/07/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977146_A/California/07/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831815_A/California/07/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977114_A/California/04/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227809828_A/California/04/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396427_A/California/08/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
                                    ***********************.**************************

gi|237511877_A/Mexico/4603/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511887_A/Mexico/4482/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229484063_A/Canada-NS/RV153      KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892778_A/Canada-NS/RV153      KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237624325_A/swine/Alberta/O      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831785_A/California/06/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831770_A/California/05/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229536083_A/Indiana/09/2009      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229783410_A/New_York/1682/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229783389_A/New_York/1669/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892772_A/Canada-NS/RV153      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511881_A/Mexico/4486/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511889_A/Mexico/4108/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511879_A/Mexico/4604/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892776_A/Canada-AB/RV153      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892782_A/Canada-ON/RV152      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892774_A/Canada-ON/RV152      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892780_A/Mexico/InDRE411      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229535826_A/California/14/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229536113_A/Michigan/02/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229536127_A/New_York/13/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229535979_A/Texas/08/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229535808_A/Texas/09/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229484067_A/Canada-ON/RV152      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229484065_A/Mexico/InDRE448      KEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396441_A/New_York/10/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396379_A/New_York/11/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396455_A/New_York/15/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396397_A/New_York/18/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396408_A/New_York/31/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396485_A/New_York/19/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396502_A/Ohio/07/2009         KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977134_A/Texas/04/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229299530_A/Texas/04/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831799_A/Texas/05/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229299510_A/Texas/05/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977170_A/California/07/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977146_A/California/07/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831815_A/California/07/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977114_A/California/04/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227809828_A/California/04/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396427_A/California/08/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
                                    ******************:*****:*************************

gi|237511877_A/Mexico/4603/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511887_A/Mexico/4482/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229484063_A/Canada-NS/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892778_A/Canada-NS/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237624325_A/swine/Alberta/O      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831785_A/California/06/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831770_A/California/05/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229536083_A/Indiana/09/2009      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229783410_A/New_York/1682/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229783389_A/New_York/1669/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892772_A/Canada-NS/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511881_A/Mexico/4486/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511889_A/Mexico/4108/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511879_A/Mexico/4604/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892776_A/Canada-AB/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892782_A/Canada-ON/RV152      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892774_A/Canada-ON/RV152      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892780_A/Mexico/InDRE411      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229535826_A/California/14/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229536113_A/Michigan/02/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229536127_A/New_York/13/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229535979_A/Texas/08/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229535808_A/Texas/09/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229484067_A/Canada-ON/RV152      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229484065_A/Mexico/InDRE448      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396441_A/New_York/10/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396379_A/New_York/11/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396455_A/New_York/15/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396397_A/New_York/18/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396408_A/New_York/31/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396485_A/New_York/19/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396502_A/Ohio/07/2009         GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977134_A/Texas/04/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229299530_A/Texas/04/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831799_A/Texas/05/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229299510_A/Texas/05/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977170_A/California/07/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977146_A/California/07/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831815_A/California/07/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977114_A/California/04/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227809828_A/California/04/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396427_A/California/08/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
                                    **************************************************

gi|237511877_A/Mexico/4603/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511887_A/Mexico/4482/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229484063_A/Canada-NS/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892778_A/Canada-NS/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237624325_A/swine/Alberta/O      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831785_A/California/06/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831770_A/California/05/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229536083_A/Indiana/09/2009      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229783410_A/New_York/1682/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229783389_A/New_York/1669/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892772_A/Canada-NS/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511881_A/Mexico/4486/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511889_A/Mexico/4108/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511879_A/Mexico/4604/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892776_A/Canada-AB/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892782_A/Canada-ON/RV152      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892774_A/Canada-ON/RV152      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892780_A/Mexico/InDRE411      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229535826_A/California/14/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229536113_A/Michigan/02/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229536127_A/New_York/13/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229535979_A/Texas/08/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229535808_A/Texas/09/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229484067_A/Canada-ON/RV152      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229484065_A/Mexico/InDRE448      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396441_A/New_York/10/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396379_A/New_York/11/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396455_A/New_York/15/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396397_A/New_York/18/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396408_A/New_York/31/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396485_A/New_York/19/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396502_A/Ohio/07/2009         EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977134_A/Texas/04/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229299530_A/Texas/04/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831799_A/Texas/05/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229299510_A/Texas/05/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977170_A/California/07/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977146_A/California/07/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831815_A/California/07/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977114_A/California/04/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227809828_A/California/04/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396427_A/California/08/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
                                    **************************************************

gi|237511877_A/Mexico/4603/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511887_A/Mexico/4482/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229484063_A/Canada-NS/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892778_A/Canada-NS/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237624325_A/swine/Alberta/O      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831785_A/California/06/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831770_A/California/05/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229536083_A/Indiana/09/2009      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229783410_A/New_York/1682/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229783389_A/New_York/1669/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892772_A/Canada-NS/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511881_A/Mexico/4486/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511889_A/Mexico/4108/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511879_A/Mexico/4604/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892776_A/Canada-AB/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892782_A/Canada-ON/RV152      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892774_A/Canada-ON/RV152      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892780_A/Mexico/InDRE411      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229535826_A/California/14/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229536113_A/Michigan/02/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229536127_A/New_York/13/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229535979_A/Texas/08/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229535808_A/Texas/09/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229484067_A/Canada-ON/RV152      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229484065_A/Mexico/InDRE448      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396441_A/New_York/10/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396379_A/New_York/11/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396455_A/New_York/15/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396397_A/New_York/18/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396408_A/New_York/31/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396485_A/New_York/19/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396502_A/Ohio/07/2009         RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977134_A/Texas/04/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229299530_A/Texas/04/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831799_A/Texas/05/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229299510_A/Texas/05/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977170_A/California/07/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977146_A/California/07/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831815_A/California/07/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977114_A/California/04/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227809828_A/California/04/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396427_A/California/08/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
                                    **************************************************

gi|237511877_A/Mexico/4603/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511887_A/Mexico/4482/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229484063_A/Canada-NS/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892778_A/Canada-NS/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237624325_A/swine/Alberta/O      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831785_A/California/06/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831770_A/California/05/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229536083_A/Indiana/09/2009      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229783410_A/New_York/1682/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229783389_A/New_York/1669/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892772_A/Canada-NS/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511881_A/Mexico/4486/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511889_A/Mexico/4108/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511879_A/Mexico/4604/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892776_A/Canada-AB/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892782_A/Canada-ON/RV152      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892774_A/Canada-ON/RV152      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892780_A/Mexico/InDRE411      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229535826_A/California/14/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229536113_A/Michigan/02/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229536127_A/New_York/13/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229535979_A/Texas/08/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229535808_A/Texas/09/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229484067_A/Canada-ON/RV152      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229484065_A/Mexico/InDRE448      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396441_A/New_York/10/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396379_A/New_York/11/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396455_A/New_York/15/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396397_A/New_York/18/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396408_A/New_York/31/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396485_A/New_York/19/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396502_A/Ohio/07/2009         SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977134_A/Texas/04/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229299530_A/Texas/04/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831799_A/Texas/05/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229299510_A/Texas/05/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977170_A/California/07/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977146_A/California/07/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831815_A/California/07/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977114_A/California/04/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227809828_A/California/04/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396427_A/California/08/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
                                    **************************************************

gi|237511877_A/Mexico/4603/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511887_A/Mexico/4482/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229484063_A/Canada-NS/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892778_A/Canada-NS/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237624325_A/swine/Alberta/O      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831785_A/California/06/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831770_A/California/05/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229536083_A/Indiana/09/2009      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229783410_A/New_York/1682/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229783389_A/New_York/1669/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892772_A/Canada-NS/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511881_A/Mexico/4486/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511889_A/Mexico/4108/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511879_A/Mexico/4604/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892776_A/Canada-AB/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892782_A/Canada-ON/RV152      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892774_A/Canada-ON/RV152      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892780_A/Mexico/InDRE411      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229535826_A/California/14/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229536113_A/Michigan/02/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229536127_A/New_York/13/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229535979_A/Texas/08/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229535808_A/Texas/09/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229484067_A/Canada-ON/RV152      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229484065_A/Mexico/InDRE448      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396441_A/New_York/10/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396379_A/New_York/11/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396455_A/New_York/15/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396397_A/New_York/18/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396408_A/New_York/31/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396485_A/New_York/19/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396502_A/Ohio/07/2009         YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977134_A/Texas/04/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229299530_A/Texas/04/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831799_A/Texas/05/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229299510_A/Texas/05/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977170_A/California/07/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977146_A/California/07/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831815_A/California/07/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977114_A/California/04/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227809828_A/California/04/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396427_A/California/08/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
                                    **************************************************

gi|237511877_A/Mexico/4603/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|237511887_A/Mexico/4482/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229484063_A/Canada-NS/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229892778_A/Canada-NS/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237624325_A/swine/Alberta/O      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|227831785_A/California/06/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|227831770_A/California/05/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229536083_A/Indiana/09/2009      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229783410_A/New_York/1682/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229783389_A/New_York/1669/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229892772_A/Canada-NS/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237511881_A/Mexico/4486/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237511889_A/Mexico/4108/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237511879_A/Mexico/4604/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892776_A/Canada-AB/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892782_A/Canada-ON/RV152      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892774_A/Canada-ON/RV152      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892780_A/Mexico/InDRE411      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229535826_A/California/14/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229536113_A/Michigan/02/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229536127_A/New_York/13/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229535979_A/Texas/08/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229535808_A/Texas/09/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229484067_A/Canada-ON/RV152      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229484065_A/Mexico/InDRE448      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396441_A/New_York/10/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396379_A/New_York/11/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396455_A/New_York/15/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396397_A/New_York/18/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396408_A/New_York/31/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396485_A/New_York/19/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396502_A/Ohio/07/2009         RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977134_A/Texas/04/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229299530_A/Texas/04/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227831799_A/Texas/05/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229299510_A/Texas/05/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977170_A/California/07/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977146_A/California/07/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227831815_A/California/07/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977114_A/California/04/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227809828_A/California/04/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396427_A/California/08/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
                                    ******************************:*******************

gi|237511877_A/Mexico/4603/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511887_A/Mexico/4482/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229484063_A/Canada-NS/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892778_A/Canada-NS/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237624325_A/swine/Alberta/O      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831785_A/California/06/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831770_A/California/05/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229536083_A/Indiana/09/2009      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229783410_A/New_York/1682/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229783389_A/New_York/1669/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892772_A/Canada-NS/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511881_A/Mexico/4486/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511889_A/Mexico/4108/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511879_A/Mexico/4604/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892776_A/Canada-AB/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892782_A/Canada-ON/RV152      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892774_A/Canada-ON/RV152      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892780_A/Mexico/InDRE411      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229535826_A/California/14/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229536113_A/Michigan/02/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229536127_A/New_York/13/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229535979_A/Texas/08/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229535808_A/Texas/09/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229484067_A/Canada-ON/RV152      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229484065_A/Mexico/InDRE448      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396441_A/New_York/10/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396379_A/New_York/11/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396455_A/New_York/15/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396397_A/New_York/18/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396408_A/New_York/31/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396485_A/New_York/19/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396502_A/Ohio/07/2009         SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977134_A/Texas/04/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229299530_A/Texas/04/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831799_A/Texas/05/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229299510_A/Texas/05/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977170_A/California/07/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977146_A/California/07/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831815_A/California/07/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977114_A/California/04/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227809828_A/California/04/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396427_A/California/08/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
                                    **************************************************

gi|237511877_A/Mexico/4603/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511887_A/Mexico/4482/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229484063_A/Canada-NS/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892778_A/Canada-NS/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237624325_A/swine/Alberta/O      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831785_A/California/06/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831770_A/California/05/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229536083_A/Indiana/09/2009      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229783410_A/New_York/1682/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229783389_A/New_York/1669/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892772_A/Canada-NS/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511881_A/Mexico/4486/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511889_A/Mexico/4108/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511879_A/Mexico/4604/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892776_A/Canada-AB/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892782_A/Canada-ON/RV152      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892774_A/Canada-ON/RV152      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892780_A/Mexico/InDRE411      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229535826_A/California/14/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229536113_A/Michigan/02/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229536127_A/New_York/13/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229535979_A/Texas/08/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229535808_A/Texas/09/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229484067_A/Canada-ON/RV152      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229484065_A/Mexico/InDRE448      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396441_A/New_York/10/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396379_A/New_York/11/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396455_A/New_York/15/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396397_A/New_York/18/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396408_A/New_York/31/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396485_A/New_York/19/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396502_A/Ohio/07/2009         ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977134_A/Texas/04/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229299530_A/Texas/04/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831799_A/Texas/05/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229299510_A/Texas/05/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977170_A/California/07/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977146_A/California/07/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831815_A/California/07/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977114_A/California/04/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227809828_A/California/04/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396427_A/California/08/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
                                    **************************************************

gi|237511877_A/Mexico/4603/200      LLNASWFNSFLTHALK 716
gi|237511887_A/Mexico/4482/200      LLNASWFNSFLTHALK 716
gi|229484063_A/Canada-NS/RV153      LLNASWFNSFLTHALK 716
gi|229892778_A/Canada-NS/RV153      LLNASWFNSFLTHALK 716
gi|237624325_A/swine/Alberta/O      LPNASWFNSFLTHALK 716
gi|227831785_A/California/06/2      LLNASWFNSFLTHALK 716
gi|227831770_A/California/05/2      LLNASWFNSFLTHALK 716
gi|229536083_A/Indiana/09/2009      LLNASWFNSFLTHALK 716
gi|229783410_A/New_York/1682/2      LLNASWFNSFLTHALK 716
gi|229783389_A/New_York/1669/2      LLNASWFNSFLTHALK 716
gi|229892772_A/Canada-NS/RV153      LLNASWFNSFLTHALK 716
gi|237511881_A/Mexico/4486/200      LLNASWFNSFLTHALK 716
gi|237511889_A/Mexico/4108/200      LLNASWFNSFLTHALK 716
gi|237511879_A/Mexico/4604/200      LLNASWFNSFLTHALK 716
gi|229892776_A/Canada-AB/RV153      LLNASWFNSFLTHALK 716
gi|229892782_A/Canada-ON/RV152      LLNASWFNSFLTHALK 716
gi|229892774_A/Canada-ON/RV152      LLNASWFNSFLTHALK 716
gi|229892780_A/Mexico/InDRE411      LLNASWFNSFLTHALK 716
gi|229535826_A/California/14/2      LLNASWFNSFLTHALK 716
gi|229536113_A/Michigan/02/200      LLNASWFNSFLTHALK 716
gi|229536127_A/New_York/13/200      LLNASWFNSFLTHALK 716
gi|229535979_A/Texas/08/2009        LLNASWFNSFLTHALK 716
gi|229535808_A/Texas/09/2009        LLNASWFNSFLTHALK 716
gi|229484067_A/Canada-ON/RV152      LLNASWFNSFLTHALK 716
gi|229484065_A/Mexico/InDRE448      LLNASWFNSFLTHALK 716
gi|229396441_A/New_York/10/200      LLNASWFNSFLTHALK 716
gi|229396379_A/New_York/11/200      LLNASWFNSFLTHALK 716
gi|229396455_A/New_York/15/200      LLNASWFNSFLTHALK 716
gi|229396397_A/New_York/18/200      LLNASWFNSFLTHALK 716
gi|229396408_A/New_York/31/200      LLNASWFNSFLTHALK 716
gi|229396485_A/New_York/19/200      LLNASWFNSFLTHALK 716
gi|229396502_A/Ohio/07/2009         LLNASWFNSFLTHALK 716
gi|227977134_A/Texas/04/2009        LLNASWFNSFLTHALK 716
gi|229299530_A/Texas/04/2009        LLNASWFNSFLTHALK 716
gi|227831799_A/Texas/05/2009        LLNASWFNSFLTHALK 716
gi|229299510_A/Texas/05/2009        LLNASWFNSFLTHALK 716
gi|227977170_A/California/07/2      LLNASWFNSFLTHALK 716
gi|227977146_A/California/07/2      LLNASWFNSFLTHALK 716
gi|227831815_A/California/07/2      LLNASWFNSFLTHALK 716
gi|227977114_A/California/04/2      LLNASWFNSFLTHALK 716
gi|227809828_A/California/04/2      LLNASWFNSFLTHALK 716
gi|229396427_A/California/08/2      LLNASWFNSFLTHALK 716
                                    * **************

BLAST

>gb|AAL87920.1|AF455722_1  polymerase acidic protein 2 [Influenza A virus (A/Swine/Illinois/100084/01 
(H1N2))]
Length=716

 Score = 1471 bits (3809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/716 (98%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRSLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+AKIEPFL+TTPRPLRLPDGP+C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAKIEPFLKTTPRPLRLPDGPLCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQS+QQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSIQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABA27439.1|  polymerase [Influenza A virus (A/swine/IN/PU542/04 (H3N1))]
Length=716

 Score = 1468 bits (3801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/716 (98%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRRE+HIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREIHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87685.1|  polymerase PA [Influenza A virus (A/pintail/Alberta/269/2001(H4N6))]
Length=716

 Score = 1468 bits (3800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+QNEFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE78077.1|  polymerase PA [Influenza A virus (A/swine/Korea/CY08/2007(H1N2))]
Length=716

 Score = 1466 bits (3796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDF+RQCFNPM VELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFMRQCFNPMTVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGV+KPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP+C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPLCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGE+MAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGESMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIAS+RRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASIRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE76580.1|  polymerase PA [Influenza A virus (A/northern shoveler/California/HKWF1370/2007(H10N3))]
Length=716

 Score = 1466 bits (3796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFVEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+QNEFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABF17997.1|  polymerase acidic protein 2 [Influenza A virus (A/swine/Alberta/14722/2005(H3N2))]
 gb|ACD88666.1|  polymerase PA [Influenza A virus (A/turkey/OH/313053/2004(H3N2))]
 gb|ACF25542.1|  polymerase PA [Influenza A virus (A/turkey/MN/366767/2005(H3N2))]
Length=716

 Score = 1466 bits (3796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGED KIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDSKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFVEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19893.1|  polymerase PA [Influenza A virus (A/mallard/Alberta/30/2001(H4N8))]
Length=716

 Score = 1466 bits (3796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFLRTTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLRTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE78078.1|  polymerase PA [Influenza A virus (A/swine/Korea/CAS05/2004(H3N2))]
Length=716

 Score = 1466 bits (3795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDE+GES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDEQGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPK LPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKLLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+AKIEPFL+TTPRPLRLPDGP+C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAKIEPFLKTTPRPLRLPDGPLCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLE HKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLESHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRP+FLYVRTNGTSKIKMKWGMEMRRCLLQSLQQ+ESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPIFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQVESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFEN+SETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENRSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>dbj|BAF41917.1|  polymerase acidic protein [Influenza A virus (A/duck/Hokkaido/120/2001(H6N2))]
Length=716

 Score = 1466 bits (3795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+QNEFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19614.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/322/1988(H1N1))]
Length=716

 Score = 1466 bits (3795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFLRTTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLRTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+G+EEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGMEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE78067.1|  polymerase PA [Influenza A virus (A/swine/Korea/CAN01/2004(H1N1))]
 gb|ACE78068.1|  polymerase PA [Influenza A virus (A/swine/Korea/CAS08/2005(H1N1))]
Length=716

 Score = 1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+ TPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKKTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP+SLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPKSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF47507.1|  polymerase PA [Influenza A virus (A/ring necked duck/California/HKWF402/2007(H6N1))]
Length=716

 Score = 1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABI92243.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/249/1998(H6N1))]
 gb|ABL75581.1|  polymerase PA [Influenza A virus (A/green-winged teal/Ohio/203/1998(H6N2))]
 gb|ABO52441.1|  polymerase PA [Influenza A virus (A/green-winged teal/Ohio/1747/2005(H11N2))]
 gb|ACE76624.1|  polymerase PA [Influenza A virus (A/northern pintail/California/HKWF792/2007(H3N8))]
 gb|ACF33659.1|  polymerase PA [Influenza A virus (A/mallard/MN/479/2000(H5N3))]
Length=716

 Score = 1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABF18001.1|  polymerase acidic protein 2 [Influenza A virus (A/turkey/Ontario/31232/2005(H3N2))]
Length=716

 Score = 1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGED KIETNKFAAICTHLE+CFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEICFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFVEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87840.1|  polymerase PA [Influenza A virus (A/red knot/NJ/325/1989(H7N7))]
Length=716

 Score = 1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFLRTTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLRTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB20075.1|  polymerase PA [Influenza A virus (A/mallard/Alberta/125/1999(H11N6))]
 gb|ABB87696.1|  polymerase PA [Influenza A virus (A/blue-winged teal/Alberta/293/2003(H4N6))]
 gb|ABI95180.1|  polymerase PA [Influenza A virus (A/gadwall/Ohio/37/1999(H6N2))]
 gb|ABL67106.1|  polymerase PA [Influenza A virus (A/mallard/Alaska/708/2005(H8N4))]
 gb|ABL67117.1|  polymerase PA [Influenza A virus (A/pintail/Alaska/779/2005(H3N8))]
 gb|ACF33691.1|  polymerase PA [Influenza A virus (A/mallard/MN/269/1999(H4N6))]
 gb|ACK28216.1|  polymerase PA [Influenza A virus (A/green-winged teal/Interior 
Alaska/1/2007(H3N8))]
 gb|ACO25332.1|  polymerase PA [Influenza A virus (A/mallard/Interior Alaska/4/2007(H3N8))]
Length=716

 Score = 1466 bits (3794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACI90168.1|  polymerase PA [Influenza A virus (A/American widgeon/Interior 
Alaska/1/2007(H3N8))]
 gb|ACO25321.1|  polymerase PA [Influenza A virus (A/northern pintail/Interior 
Alaska/2/2007(H4N8))]
Length=716

 Score = 1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SW+ELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWMELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF25295.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/NJ/1956/2001(H10N7))]
 gb|ACF25306.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/NJ/1605/2001(H10N7))]
 gb|ACF25328.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/NJ/823/2001(H10N7))]
 gb|ACF25438.1|  polymerase PA [Influenza A virus (A/red knot/DE/1587/2001(H10N7))]
Length=716

 Score = 1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            +IVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   VIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABL67139.1|  polymerase PA [Influenza A virus (A/longtail duck/Maryland/291/2005(H3N8))]
Length=716

 Score = 1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+T QLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTIQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABF17996.1|  polymerase acidic protein 2 [Influenza A virus (A/Ontario/RV1273/2005(H3N2))]
 gb|ABF18000.1|  polymerase acidic protein 2 [Influenza A virus (A/swine/Ontario/33853/2005(H3N2))]
 gb|ACF04399.1|  polymerase PA [Influenza A virus (A/swine/Quebec/4001/2005(H3N2))]
Length=716

 Score = 1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGED KIETNKFAAICTHLE+CFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDSKIETNKFAAICTHLEICFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFVEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87985.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/40/1984(H10N6))]
 gb|ABB87996.1|  polymerase PA [Influenza A virus (A/pintail duck/ALB/584/1984(H10N6))]
Length=716

 Score = 1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFLRTTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLRTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19942.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/435/1985(H7N3))]
Length=716

 Score = 1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDINDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACG59817.1|  polymerase PA [Influenza A virus (A/turkey/TX/10-49-89/1989(H9N2))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMA+R LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMATRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPH+KGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHDKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+QNEFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVNDLKQYDSDEPEPRSLASWIQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF24998.1|  polymerase PA [Influenza A virus (A/mallard/MN/351/1999(H3N1))]
 gb|ACF25219.1|  polymerase PA [Influenza A virus (A/mallard/MN/330/1999(H3N1))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPR+LASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRTLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE81746.1|  polymerase PA [Influenza A virus (A/ring-necked duck/California/HKWF662/2007(H6N1))]
 gb|ACF47485.1|  polymerase PA [Influenza A virus (A/American wigeon/California/HKWF296/2007(H6N1))]
 gb|ACF47518.1|  polymerase PA [Influenza A virus (A/American wigeon/California/HKWF41/2007(H6N1))]
 gb|ACJ04597.1|  polymerase PA [Influenza A virus (A/northern pintail/California/HKWF151/2007(H6N1))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPE RSLASW+QNEFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPESRSLASWIQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABI19008.1|  polymerase PA [Influenza A virus (A/Iowa/CEID23/2005(H1N1))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP+SLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPKSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIAS+RRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASIRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRP+FLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPLFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|AAO65607.1|  acidic protein 2 [Influenza A virus (A/duck/NC/91347/01(H1N2))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKT IHIFSFTGEEMAT+ADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTQIHIFSFTGEEMATRADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGF+PNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFKPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+AKIEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAKIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRL+PHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLKPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQ+ESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQVESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB88316.1|  polymerase PA [Influenza A virus (A/black duck/AUS/751/1978(H3N8))]
 gb|ABX88850.1|  polymerase PA [Influenza A virus (A/black duck/Western Australia/4954/1983(H3N8))]
 gb|ABY51499.1|  polymerase PA [Influenza A virus (A/black duck/Perth/699/1978(H3N8))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCFQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB88007.1|  polymerase PA [Influenza A virus (A/mallard/ALB/5/1995(H10N1))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFLRTTPRPL+LPDGP C QRSKFL+MDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLRTTPRPLKLPDGPPCSQRSKFLMMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87807.1|  polymerase PA [Influenza A virus (A/green-winged teal/ALB/228/1985(H7N3))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDISDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87447.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/635/1983(H3N5))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFLRTTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLRTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHAL+
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALR  716


>gb|ABB20158.1|  polymerase PA [Influenza A virus (A/sanderling/DE/1258/1986(H6N6))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB20017.1|  polymerase PA [Influenza A virus (A/redhead duck/Alberta/357/1983(H11N9))]
 gb|ABB20023.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/763/1983(H11N8))]
 gb|ABB87892.1|  polymerase PA [Influenza A virus (A/laughing gull/DE/2718/1987(H9N5))]
 gb|ABI84802.1|  polymerase PA [Influenza A virus (A/mallard duck/New York/180/1986(H4N9))]
 gb|ABJ53577.1|  polymerase PA [Influenza A virus (A/bufflehead/Ohio/246/1986(H11N2))]
 gb|ABL67040.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/324/1988(H4N6))]
 gb|ABL67249.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/407/1987(H12N5))]
 gb|ABK80021.2|  polymerase PA [Influenza A virus (A/mallard/Ohio/424/1988(H3N2))]
Length=716

 Score = 1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACN86683.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/New Jersey/Sg-00561/2008(H11N9))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            ME+FVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEEFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACK43372.1|  polymerase PA [Influenza A virus (A/mallard/Minnesota/371/1998(H4N2))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLELPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE78071.1|  polymerase PA [Influenza A virus (A/swine/Korea/JL02/2005(H1N2))]
 gb|ACE78074.1|  polymerase PA [Influenza A virus (A/swine/Korea/PZ4/2006(H1N2))]
 gb|ACE78075.1|  polymerase PA [Influenza A virus (A/swine/Korea/PZ7/2006(H1N2))]
 gb|ACE78076.1|  polymerase PA [Influenza A virus (A/swine/Korea/PZ14/2006(H1N2))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDP+IETNKFAAICTHLE+CFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPRIETNKFAAICTHLEICFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWT+VNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRNMAWTMVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSF GEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFAGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+AKIEPFL+TTPRPLRLPDGP+C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAKIEPFLKTTPRPLRLPDGPLCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGE+MAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGESMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIAS+RRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASIRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABM22000.1|  polymerase PA [Influenza A virus (A/snow goose/Maryland/353/2005(H6N1))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTL+AKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLMAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABK79944.1|  polymerase PA [Influenza A virus (A/pintail/Alaska/211/2005(H3N8))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE+
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEV  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|AAY87438.1|  polymerase acid subunit [Influenza A virus (A/mallard/Alberta/24/01(H7N3))]
 gb|AAY87442.1|  polymerase acid subunit [Influenza A virus (A/mallard/Alberta/24/01(H7N3))]
 gb|ABI84435.1|  polymerase PA [Influenza A virus (A/mallard/Alberta/34/2001(H7N1))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTA+LNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTAMLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB88201.1|  polymerase PA [Influenza A virus (A/Duck/Nanchang/4-165/2000(H4N6))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGV+KPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP+C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPLCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFEN+SETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENRSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABC59714.1|  polymerase [Influenza A virus (A/turkey/Ohio/313053/04(H3N2))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGED KIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDSKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFVEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLS+EDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSVEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFT+EVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTSEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB88305.1|  polymerase PA [Influenza A virus (A/duck/Hong Kong/24/1976(H4N2))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL+TIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLYTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19771.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/299/1977(H4N4))]
 gb|ABB19911.1|  polymerase PA [Influenza A virus (A/blue-winged teal/ALB/39/1982(H8N4))]
 gb|ABB87502.1|  polymerase PA [Influenza A virus (A/redhead duck/ALB/74/1977(H4N6))]
 gb|ABI48024.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/275/1987(H4N2))]
 gb|ABI92210.1|  polymerase PA [Influenza A virus (A/green-winged teal/Ohio/344/1986(H4N2))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19001.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/761/1978(H6N8))]
 gb|ABI84690.1|  polymerase PA [Influenza A virus (A/turkey/Minnesota/1200/1980(H7N3))]
 gb|ABI92221.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/83/1986(H4N6))]
 gb|ABI92232.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/338/1986(H4N8))]
 gb|ACK43324.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/338/1986(H4N8))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDISDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB17721.1|  polymerase PA [Influenza A virus (A/sanderling/NJ/766/1986(H2N7))]
 gb|ABB19506.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/NJ/51/1985(H11N1))]
Length=716

 Score = 1464 bits (3791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMAT+ADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATRADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIPRTKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPRTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACO25343.1|  polymerase PA [Influenza A virus (A/American green-winged teal/Interior 
Alaska/3/2007(H3N8))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 710/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADY LDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYILDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACN86437.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/Delaware/Sg-00469/2008(H3N2))]
 gb|ACN86599.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/New Jersey/Sg-00522/2008(H3N7))]
 gb|ACN86623.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/New Jersey/Sg-00533/2008(H4N6))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGF+PNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFKPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACI90179.1|  polymerase PA [Influenza A virus (A/northern shoveler/Interior 
Alaska/1/2007(H3N8))]
 gb|ACJ04584.1|  polymerase PA [Influenza A virus (A/mallard/Interior Alaska/1/2007(H3N8))]
 gb|ACO25310.1|  polymerase PA [Influenza A virus (A/mallard/Interior Alaska/3/2007(H3N8))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRRE+HIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREIHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SW+ELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWMELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF25273.1|  polymerase PA [Influenza A virus (A/mallard/MN/42/2000(H11N9))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKA+YTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAEYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDE+GEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEMGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE76547.1|  polymerase PA [Influenza A virus (A/gadwall/California/HKWF100/2007(H6N1))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQS+PPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSIPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABO52463.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/1851/2005(H11N1))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMT+EFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTREFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABH04378.1|  polymerase acid protein [Influenza A virus (A/turkey/Oregon/1971(H7N3))]
 gb|ABH04384.1|  polymerase acid protein [Influenza A virus (A/turkey/Oregon/1971(H7N3))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPE RSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEQRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABI92188.1|  polymerase PA [Influenza A virus (A/black duck/Ohio/95/1993(H1N1))]
 gb|ABM21967.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/118/1993(H1N1))]
 gb|ABO52562.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/94/1993(H11N3))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+ DLKQYDSDEPEPRSLASW+QNEFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDISDLKQYDSDEPEPRSLASWIQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SW+ELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWMELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABF17999.1|  polymerase acidic protein 2 [Influenza A virus (A/swine/Manitoba/12707/2005(H3N2))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGED KIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDSKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFVEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+A+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAQIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEKVDFD+CKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKVDFDECKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWE+Y
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWERY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87829.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/DE/2378/1988(H7N7))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTG+EKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRAMAWTVVNSICNTTGIEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB87202.1|  polymerase PA [Influenza A virus (A/pintail/Alberta/49/2003(H12N5))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHE+GINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHERGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB21758.1|  polymerase PA [Influenza A virus (A/shoveler/Netherlands/19/1999(H11N9))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            II+ESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IILESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19843.1|  polymerase PA [Influenza A virus (A/blue-winged teal/ALB/67/1990(H4N5))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIEN+EKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENDEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19411.1|  polymerase PA [Influenza A virus (A/shorebird/DE/12/2004(H6N8))]
 gb|ACF25372.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/DE/167/2004(H10N7))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIE+PSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIENPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB17699.1|  polymerase PA [Influenza A virus (A/mallard/Alberta/884/1984(H2N5))]
 gb|ABB19421.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/65/1976(H1N1))]
 gb|ABB19719.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/525/1985(H3N8))]
 gb|ABB20000.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/DE/2764/1987(H10N7))]
 gb|ABB21826.1|  polymerase PA [Influenza A virus (A/turkey/Minnesota/833/1980(H4N2))]
 gb|ABB86803.1|  polymerase PA [Influenza A virus (A/mallard duck/ALB/676/1979(H3N6))]
 gb|ACF33757.1|  polymerase PA [Influenza A virus (A/green-winged teal/LA/9GW/1987(H11N9))]
Length=716

 Score = 1464 bits (3790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDISDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACK99384.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/108/2007(H7N3))]
 gb|ACK99395.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/121/2007(H7N3))]
 gb|ACK99406.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/123/2007(H7N3))]
 gb|ACO95708.1|  polymerase PA [Influenza A virus (A/ruddy turnstone/Delaware 
Bay/124/2007(H7N3))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTA+LNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTAMLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACK99362.1|  polymerase PA [Influenza A virus (A/mallard/Wisconsin/944/1982(H5N2))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTA+GQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAVGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE78070.1|  polymerase PA [Influenza A virus (A/swine/Korea/JL01/2005(H1N2))]
 gb|ACE78072.1|  polymerase PA [Influenza A virus (A/swine/Korea/JL04/2005(H1N2))]
 gb|ACE78073.1|  polymerase PA [Influenza A virus (A/swine/Korea/Asan04/2006(H1N2))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDP+IETNKFAAICTHLE+CFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPRIETNKFAAICTHLEICFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWT+VNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRNMAWTMVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEV+AKIEPFL+TTPRPL+LPDGP+C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVSAKIEPFLKTTPRPLKLPDGPLCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            KRTSQLKWALGENMAPEK+DFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS
Sbjct  361  KRTSQLKWALGENMAPEKIDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNG SKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGISKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFE+KSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFESKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF47419.1|  polymerase PA [Influenza A virus (A/northern shoveler/California/HKWF1128/2007(H2N7))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDA KCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDATKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF25208.1|  polymerase PA [Influenza A virus (A/mallard/MN/259/1999(H3N6))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA++EPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARVEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+ WKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLTWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF24937.1|  polymerase PA [Influenza A virus (A/quail/PA/20304/1998(H7N2))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKF+AICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFSAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESM+EAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMVEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACE76558.1|  polymerase PA [Influenza A virus (A/northern shoveler/California/HKWF1201/2007(H3N5))]
 gb|ACF47463.1|  polymerase PA [Influenza A virus (A/northern shoveler/California/HKWF1367/2007(H3N7))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQY+SDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYNSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABP49257.1|  polymerase PA [Influenza A virus (A/black duck/Ohio/161/1999(H11N9))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPE RSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPESRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABO52540.1|  polymerase PA [Influenza A virus (A/green-winged teal/Ohio/1324/2005(H4N6))]
 gb|ABO52661.1|  polymerase PA [Influenza A virus (A/green-winged teal/Ohio/1324/2005(H4N6))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKF AICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFTAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWP+GESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPVGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABO52122.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/122/1989(H10N7))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE+
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEV  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABO51836.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/48/1986(H3N2))]
 gb|ABO64350.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/181/1986(H3N1))]
 gb|ABP49279.1|  polymerase PA [Influenza A virus (A/green-winged teal/Ohio/496/1987(H11N9))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SW+ELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWMELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABL67150.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/99/1989(H10N7))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+E+EEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLESEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SW+ELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWMELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|AAV91209.1|  polymerase [Influenza A virus (A/black-headed gull/Sweden/1/99(H13N6))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            +IVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   VIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDINDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB20236.1|  polymerase PA [Influenza A virus (A/duck/Hong Kong/319/1978(H2N2))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 710/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAA+CTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAVCTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+ WKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLTWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19818.1|  polymerase PA [Influenza A virus (A/knot/DE/541/1988(H4N6))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRF+EI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFLEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB17753.1|  polymerase PA [Influenza A virus (A/mallard duck/Alberta/323/1988(H2N1))]
Length=716

 Score = 1464 bits (3789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEET+EE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETVEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDISDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACJ14474.1|  polymerase PA [Influenza A virus (A/duck/Italy/281904/2006(H1N1))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGV+KPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEEKFEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEEKFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDS+EPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSEEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACJ10023.1|  polymerase PA [Influenza A virus (A/Muscovy duck/New York/62095-1/2006(H5N2))]
 gb|ACO95631.1|  polymerase PA [Influenza A virus (A/unknown/New York/78436/2006(H5N2))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSK VNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKAVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACI90157.1|  polymerase PA [Influenza A virus (A/mallard/Interior Alaska/2/2007(H3N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPN++KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNVIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SW+ELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWMELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ACF47551.1|  polymerase PA [Influenza A virus (A/American wigeon/California/HKWF541/2007(H6N5))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSF THALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFFTHALK  716


>gb|ACA04625.1|  polymerase PA [Influenza A virus (A/blue-winged teal/Ohio/1864/2006(H3N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            +IVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKE+RFIE+
Sbjct  61   VIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKESRFIEV  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABQ81826.1|  polymerase PA [Influenza A virus (A/mallard/Hei Longjiang/131/2006(H6N2))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 710/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGED KIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDSKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABQ23873.1|  polymerase PA [Influenza A virus (A/mallard/SanJiang/151/2006(H6N2))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEK+P+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKVPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHAL+
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALR  716


>gb|ABO76920.1|  polymerase PA [Influenza A virus (A/pintail/Alaska/49/2005(H3N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKV+F+DCKD+GDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVEFEDCKDIGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABO52100.1|  polymerase PA [Influenza A virus (A/common scoter/Maryland/297/2005(H10N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL++PDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKMPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCR TEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRVTEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABO51935.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/668/2002(H4N6))]
 gb|ACG59849.1|  polymerase PA [Influenza A virus (A/mallard/MD/199/2003(H1N1))]
 gb|ACG59869.1|  polymerase PA [Influenza A virus (A/mallard/MD/185/2003(H5N2))]
 gb|ACI40985.1|  polymerase PA [Influenza A virus (A/mallard/MD/53/2003(H1N1))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGV+KPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQD+E+EEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDLESEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABI95481.1|  polymerase PA [Influenza A virus (A/pintail/Ohio/454/1987(H3N8))]
 gb|ABL67848.1|  polymerase PA [Influenza A virus (A/northern shoveler/Ohio/454/1987(H3N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPH+KGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHDKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKD+ DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDINDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIG+DVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGDDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABI92265.1|  polymerase PA [Influenza A virus (A/mallard/Alaska/256/2005(H3N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKD+GDLKQYDS+EPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDIGDLKQYDSNEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLY+RTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYIRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABG88285.1|  polymerase PA [Influenza A virus (A/pintail/Alaska/20/2005(H12N5))]
 gb|ABL67084.1|  polymerase PA [Influenza A virus (A/pintail/Alaska/102/2005(H12N5))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHE+GINPNYL+AWKQVLAELQD+ENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHERGINPNYLLAWKQVLAELQDLENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLE+GDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEVGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFEN+SETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENRSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABG88241.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/97/1989(H4N2))]
 gb|ABI97494.1|  polymerase PA [Influenza A virus (A/mallard/Ohio/94/1989(H4N2))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKP+FLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPRFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|AAT12138.1|  polymerase [Influenza A virus (A/duck/Guangxi/35/2001(H5N1))]
 dbj|BAF02909.2|  polymerase acidic protein [Influenza A virus (A/duck/Mongolia/47/2001(H7N1))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DL+QYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLRQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB20358.1|  polymerase PA [Influenza A virus (A/gray teal/Australia/1/1979(H6N1))]
 gb|ABX88817.1|  polymerase PA [Influenza A virus (A/Eurasian coot/Western Australia/2727/1979(H6N2))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDP+HEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCFQRSKFLLMDALKLSIEDPNHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB20349.1|  polymerase PA [Influenza A virus (A/shearwater/Australia/405/1978(H3N8))]
 gb|ABY51521.1|  polymerase PA [Influenza A virus (A/wedge-tailed shearwater/Western 
Australia/405/1977(H3N8))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/716 (97%), Positives = 710/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSS ENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSFENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCFQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB20082.1|  polymerase PA [Influenza A virus (A/pintail duck/ALB/306/1983(H12N5))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/716 (97%), Positives = 711/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKD+ DLKQY+SDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDISDLKQYNSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19874.1|  polymerase PA [Influenza A virus (A/mallard/ALB/47/1998(H4N1))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 710/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEI GTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEIAGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPLRLPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQDIENEEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDFDDCKDV DLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFDDCKDVSDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGED+APIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDIAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESP+GVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716


>gb|ABB19854.1|  polymerase PA [Influenza A virus (A/mallard/ALB/49/1995(H4N6))]
 gb|ABB88117.1|  polymerase PA [Influenza A virus (A/green-winged teal/ALB/199/1991(H12N5))]
Length=716

 Score = 1463 bits (3788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/716 (97%), Positives = 712/716 (99%), Gaps = 0/716 (0%)

Query  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60
            MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES
Sbjct  1    MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGES  60

Query  61   IIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120
            IIVESGDPNALLKHRFEIIEGRDR MAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI
Sbjct  61   IIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEI  120

Query  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180
            GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
Sbjct  121  GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ  180

Query  181  EMASRSLWDSFRQSERGEETIEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG  240
            EMASR LWDSFRQSERGEETIEE+FEITGTMR+LADQSLPPNFSSLENFRAYVDGFEPNG
Sbjct  181  EMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNG  240

Query  241  CIEGKLSQMSKEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE  300
            CIEGKLSQMSKEVNA+IEPFL+TTPRPL+LPDGP C QRSKFLLMDALKLSIEDPSHEGE
Sbjct  241  CIEGKLSQMSKEVNARIEPFLKTTPRPLKLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE  300

Query  301  GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIENEEKIPRTKNM  360
            GIPLYDAIKCMKTFFGWKEPNI+KPHEKGINPNYL+AWKQVLAELQD+E+EEKIP+TKNM
Sbjct  301  GIPLYDAIKCMKTFFGWKEPNIIKPHEKGINPNYLLAWKQVLAELQDLESEEKIPKTKNM  360

Query  361  KRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEPRSLASWVQNEFNKACELTDS  420
            K+TSQLKWALGENMAPEKVDF+DCKDVGDLKQYDSDEPEPRSLASW+Q+EFNKACELTDS
Sbjct  361  KKTSQLKWALGENMAPEKVDFEDCKDVGDLKQYDSDEPEPRSLASWIQSEFNKACELTDS  420

Query  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480
            SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
Sbjct  421  SWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF  480

Query  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540
            QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
Sbjct  481  QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY  540

Query  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600
            CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
Sbjct  541  CVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES  600

Query  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660
            SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA
Sbjct  601  SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSA  660

Query  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716
            ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK
Sbjct  661  ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK  716

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools