User:Michael Strong/H1N1/PA/MSA

From Proteopedia

Jump to: navigation, search

H1N1 Swine Flu Multiple Sequence Alignment of PA Protein, 42 sequences

PA Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009, residues 257-716, 97% sequence identity to pdp template 3cm8

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
PA S224P 227977170_A/California/07/2 6
PA R269K 229484063_A/Canada-NS/RV153 2
PA L275I 229484065_A/Mexico/InDRE448 all others
PA M581L 237511889_A/Mexico/4108/200 11
PA L702P 237624325_A/swine/Alberta/O 1

gi|237511877_A/Mexico/4603/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511887_A/Mexico/4482/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229484063_A/Canada-NS/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892778_A/Canada-NS/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237624325_A/swine/Alberta/O      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831785_A/California/06/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831770_A/California/05/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229536083_A/Indiana/09/2009      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229783410_A/New_York/1682/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229783389_A/New_York/1669/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892772_A/Canada-NS/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511881_A/Mexico/4486/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511889_A/Mexico/4108/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|237511879_A/Mexico/4604/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892776_A/Canada-AB/RV153      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892782_A/Canada-ON/RV152      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892774_A/Canada-ON/RV152      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229892780_A/Mexico/InDRE411      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229535826_A/California/14/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229536113_A/Michigan/02/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229536127_A/New_York/13/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229535979_A/Texas/08/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229535808_A/Texas/09/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229484067_A/Canada-ON/RV152      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229484065_A/Mexico/InDRE448      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396441_A/New_York/10/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396379_A/New_York/11/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396455_A/New_York/15/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396397_A/New_York/18/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396408_A/New_York/31/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396485_A/New_York/19/200      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396502_A/Ohio/07/2009         MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977134_A/Texas/04/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229299530_A/Texas/04/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831799_A/Texas/05/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229299510_A/Texas/05/2009        MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977170_A/California/07/2      MEDFVRQCFNPMIVELAXKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977146_A/California/07/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227831815_A/California/07/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227977114_A/California/04/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|227809828_A/California/04/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
gi|229396427_A/California/08/2      MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 50
                                    ***************** ********************************

gi|237511877_A/Mexico/4603/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511887_A/Mexico/4482/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229484063_A/Canada-NS/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892778_A/Canada-NS/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237624325_A/swine/Alberta/O      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831785_A/California/06/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831770_A/California/05/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229536083_A/Indiana/09/2009      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229783410_A/New_York/1682/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229783389_A/New_York/1669/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892772_A/Canada-NS/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511881_A/Mexico/4486/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511889_A/Mexico/4108/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|237511879_A/Mexico/4604/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892776_A/Canada-AB/RV153      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892782_A/Canada-ON/RV152      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892774_A/Canada-ON/RV152      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229892780_A/Mexico/InDRE411      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229535826_A/California/14/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229536113_A/Michigan/02/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229536127_A/New_York/13/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229535979_A/Texas/08/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229535808_A/Texas/09/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229484067_A/Canada-ON/RV152      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229484065_A/Mexico/InDRE448      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396441_A/New_York/10/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396379_A/New_York/11/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396455_A/New_York/15/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396397_A/New_York/18/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396408_A/New_York/31/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396485_A/New_York/19/200      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396502_A/Ohio/07/2009         FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977134_A/Texas/04/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229299530_A/Texas/04/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831799_A/Texas/05/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229299510_A/Texas/05/2009        FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977170_A/California/07/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977146_A/California/07/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227831815_A/California/07/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227977114_A/California/04/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|227809828_A/California/04/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
gi|229396427_A/California/08/2      FHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSICNTTGV 100
                                    **************************************************

gi|237511877_A/Mexico/4603/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511887_A/Mexico/4482/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229484063_A/Canada-NS/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892778_A/Canada-NS/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237624325_A/swine/Alberta/O      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831785_A/California/06/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831770_A/California/05/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229536083_A/Indiana/09/2009      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229783410_A/New_York/1682/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229783389_A/New_York/1669/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892772_A/Canada-NS/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511881_A/Mexico/4486/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511889_A/Mexico/4108/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|237511879_A/Mexico/4604/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892776_A/Canada-AB/RV153      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892782_A/Canada-ON/RV152      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892774_A/Canada-ON/RV152      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229892780_A/Mexico/InDRE411      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229535826_A/California/14/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229536113_A/Michigan/02/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229536127_A/New_York/13/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229535979_A/Texas/08/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229535808_A/Texas/09/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229484067_A/Canada-ON/RV152      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229484065_A/Mexico/InDRE448      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396441_A/New_York/10/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396379_A/New_York/11/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396455_A/New_York/15/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396397_A/New_York/18/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396408_A/New_York/31/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396485_A/New_York/19/200      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396502_A/Ohio/07/2009         EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977134_A/Texas/04/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229299530_A/Texas/04/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831799_A/Texas/05/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229299510_A/Texas/05/2009        EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977170_A/California/07/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977146_A/California/07/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227831815_A/California/07/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227977114_A/California/04/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|227809828_A/California/04/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
gi|229396427_A/California/08/2      EKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSF 150
                                    **************************************************

gi|237511877_A/Mexico/4603/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511887_A/Mexico/4482/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229484063_A/Canada-NS/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892778_A/Canada-NS/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237624325_A/swine/Alberta/O      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831785_A/California/06/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831770_A/California/05/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229536083_A/Indiana/09/2009      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229783410_A/New_York/1682/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229783389_A/New_York/1669/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892772_A/Canada-NS/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511881_A/Mexico/4486/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511889_A/Mexico/4108/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|237511879_A/Mexico/4604/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892776_A/Canada-AB/RV153      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892782_A/Canada-ON/RV152      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892774_A/Canada-ON/RV152      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229892780_A/Mexico/InDRE411      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229535826_A/California/14/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229536113_A/Michigan/02/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229536127_A/New_York/13/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229535979_A/Texas/08/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229535808_A/Texas/09/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229484067_A/Canada-ON/RV152      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229484065_A/Mexico/InDRE448      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396441_A/New_York/10/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396379_A/New_York/11/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396455_A/New_York/15/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396397_A/New_York/18/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396408_A/New_York/31/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396485_A/New_York/19/200      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396502_A/Ohio/07/2009         TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977134_A/Texas/04/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229299530_A/Texas/04/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831799_A/Texas/05/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229299510_A/Texas/05/2009        TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977170_A/California/07/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977146_A/California/07/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227831815_A/California/07/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227977114_A/California/04/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|227809828_A/California/04/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
gi|229396427_A/California/08/2      TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGEET 200
                                    **************************************************

gi|237511877_A/Mexico/4603/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511887_A/Mexico/4482/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229484063_A/Canada-NS/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892778_A/Canada-NS/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237624325_A/swine/Alberta/O      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831785_A/California/06/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831770_A/California/05/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229536083_A/Indiana/09/2009      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229783410_A/New_York/1682/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229783389_A/New_York/1669/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892772_A/Canada-NS/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511881_A/Mexico/4486/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511889_A/Mexico/4108/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|237511879_A/Mexico/4604/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892776_A/Canada-AB/RV153      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892782_A/Canada-ON/RV152      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892774_A/Canada-ON/RV152      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229892780_A/Mexico/InDRE411      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229535826_A/California/14/2      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229536113_A/Michigan/02/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229536127_A/New_York/13/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229535979_A/Texas/08/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229535808_A/Texas/09/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229484067_A/Canada-ON/RV152      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229484065_A/Mexico/InDRE448      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396441_A/New_York/10/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396379_A/New_York/11/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396455_A/New_York/15/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396397_A/New_York/18/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396408_A/New_York/31/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396485_A/New_York/19/200      IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396502_A/Ohio/07/2009         IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977134_A/Texas/04/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229299530_A/Texas/04/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831799_A/Texas/05/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229299510_A/Texas/05/2009        IEEKFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977170_A/California/07/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977146_A/California/07/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227831815_A/California/07/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227977114_A/California/04/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|227809828_A/California/04/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
gi|229396427_A/California/08/2      IEEKFEITGTMRKLADQSLPPNFPSLENFRAYVDGFEPNGCIEGKLSQMS 250
                                    ***********************.**************************

gi|237511877_A/Mexico/4603/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511887_A/Mexico/4482/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229484063_A/Canada-NS/RV153      KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892778_A/Canada-NS/RV153      KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237624325_A/swine/Alberta/O      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831785_A/California/06/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831770_A/California/05/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229536083_A/Indiana/09/2009      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229783410_A/New_York/1682/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229783389_A/New_York/1669/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892772_A/Canada-NS/RV153      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511881_A/Mexico/4486/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511889_A/Mexico/4108/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|237511879_A/Mexico/4604/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892776_A/Canada-AB/RV153      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892782_A/Canada-ON/RV152      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892774_A/Canada-ON/RV152      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229892780_A/Mexico/InDRE411      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229535826_A/California/14/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229536113_A/Michigan/02/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229536127_A/New_York/13/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229535979_A/Texas/08/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229535808_A/Texas/09/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229484067_A/Canada-ON/RV152      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229484065_A/Mexico/InDRE448      KEVNAKIEPFLRTTPRPLRLPDGPICHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396441_A/New_York/10/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396379_A/New_York/11/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396455_A/New_York/15/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396397_A/New_York/18/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396408_A/New_York/31/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396485_A/New_York/19/200      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396502_A/Ohio/07/2009         KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977134_A/Texas/04/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229299530_A/Texas/04/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831799_A/Texas/05/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229299510_A/Texas/05/2009        KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977170_A/California/07/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977146_A/California/07/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227831815_A/California/07/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227977114_A/California/04/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|227809828_A/California/04/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
gi|229396427_A/California/08/2      KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
                                    ******************:*****:*************************

gi|237511877_A/Mexico/4603/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511887_A/Mexico/4482/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229484063_A/Canada-NS/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892778_A/Canada-NS/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237624325_A/swine/Alberta/O      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831785_A/California/06/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831770_A/California/05/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229536083_A/Indiana/09/2009      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229783410_A/New_York/1682/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229783389_A/New_York/1669/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892772_A/Canada-NS/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511881_A/Mexico/4486/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511889_A/Mexico/4108/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|237511879_A/Mexico/4604/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892776_A/Canada-AB/RV153      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892782_A/Canada-ON/RV152      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892774_A/Canada-ON/RV152      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229892780_A/Mexico/InDRE411      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229535826_A/California/14/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229536113_A/Michigan/02/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229536127_A/New_York/13/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229535979_A/Texas/08/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229535808_A/Texas/09/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229484067_A/Canada-ON/RV152      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229484065_A/Mexico/InDRE448      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396441_A/New_York/10/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396379_A/New_York/11/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396455_A/New_York/15/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396397_A/New_York/18/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396408_A/New_York/31/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396485_A/New_York/19/200      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396502_A/Ohio/07/2009         GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977134_A/Texas/04/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229299530_A/Texas/04/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831799_A/Texas/05/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229299510_A/Texas/05/2009        GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977170_A/California/07/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977146_A/California/07/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227831815_A/California/07/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227977114_A/California/04/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|227809828_A/California/04/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
gi|229396427_A/California/08/2      GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLMAWKQVLAELQDIEN 350
                                    **************************************************

gi|237511877_A/Mexico/4603/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511887_A/Mexico/4482/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229484063_A/Canada-NS/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892778_A/Canada-NS/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237624325_A/swine/Alberta/O      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831785_A/California/06/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831770_A/California/05/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229536083_A/Indiana/09/2009      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229783410_A/New_York/1682/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229783389_A/New_York/1669/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892772_A/Canada-NS/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511881_A/Mexico/4486/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511889_A/Mexico/4108/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|237511879_A/Mexico/4604/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892776_A/Canada-AB/RV153      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892782_A/Canada-ON/RV152      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892774_A/Canada-ON/RV152      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229892780_A/Mexico/InDRE411      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229535826_A/California/14/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229536113_A/Michigan/02/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229536127_A/New_York/13/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229535979_A/Texas/08/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229535808_A/Texas/09/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229484067_A/Canada-ON/RV152      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229484065_A/Mexico/InDRE448      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396441_A/New_York/10/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396379_A/New_York/11/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396455_A/New_York/15/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396397_A/New_York/18/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396408_A/New_York/31/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396485_A/New_York/19/200      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396502_A/Ohio/07/2009         EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977134_A/Texas/04/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229299530_A/Texas/04/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831799_A/Texas/05/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229299510_A/Texas/05/2009        EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977170_A/California/07/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977146_A/California/07/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227831815_A/California/07/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227977114_A/California/04/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|227809828_A/California/04/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
gi|229396427_A/California/08/2      EEKIPRTKNMKRTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPEP 400
                                    **************************************************

gi|237511877_A/Mexico/4603/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511887_A/Mexico/4482/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229484063_A/Canada-NS/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892778_A/Canada-NS/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237624325_A/swine/Alberta/O      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831785_A/California/06/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831770_A/California/05/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229536083_A/Indiana/09/2009      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229783410_A/New_York/1682/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229783389_A/New_York/1669/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892772_A/Canada-NS/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511881_A/Mexico/4486/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511889_A/Mexico/4108/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|237511879_A/Mexico/4604/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892776_A/Canada-AB/RV153      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892782_A/Canada-ON/RV152      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892774_A/Canada-ON/RV152      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229892780_A/Mexico/InDRE411      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229535826_A/California/14/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229536113_A/Michigan/02/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229536127_A/New_York/13/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229535979_A/Texas/08/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229535808_A/Texas/09/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229484067_A/Canada-ON/RV152      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229484065_A/Mexico/InDRE448      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396441_A/New_York/10/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396379_A/New_York/11/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396455_A/New_York/15/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396397_A/New_York/18/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396408_A/New_York/31/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396485_A/New_York/19/200      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396502_A/Ohio/07/2009         RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977134_A/Texas/04/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229299530_A/Texas/04/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831799_A/Texas/05/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229299510_A/Texas/05/2009        RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977170_A/California/07/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977146_A/California/07/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227831815_A/California/07/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227977114_A/California/04/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|227809828_A/California/04/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
gi|229396427_A/California/08/2      RSLASWVQNEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV 450
                                    **************************************************

gi|237511877_A/Mexico/4603/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511887_A/Mexico/4482/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229484063_A/Canada-NS/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892778_A/Canada-NS/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237624325_A/swine/Alberta/O      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831785_A/California/06/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831770_A/California/05/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229536083_A/Indiana/09/2009      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229783410_A/New_York/1682/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229783389_A/New_York/1669/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892772_A/Canada-NS/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511881_A/Mexico/4486/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511889_A/Mexico/4108/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|237511879_A/Mexico/4604/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892776_A/Canada-AB/RV153      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892782_A/Canada-ON/RV152      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892774_A/Canada-ON/RV152      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229892780_A/Mexico/InDRE411      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229535826_A/California/14/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229536113_A/Michigan/02/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229536127_A/New_York/13/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229535979_A/Texas/08/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229535808_A/Texas/09/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229484067_A/Canada-ON/RV152      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229484065_A/Mexico/InDRE448      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396441_A/New_York/10/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396379_A/New_York/11/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396455_A/New_York/15/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396397_A/New_York/18/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396408_A/New_York/31/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396485_A/New_York/19/200      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396502_A/Ohio/07/2009         SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977134_A/Texas/04/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229299530_A/Texas/04/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831799_A/Texas/05/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229299510_A/Texas/05/2009        SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977170_A/California/07/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977146_A/California/07/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227831815_A/California/07/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227977114_A/California/04/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|227809828_A/California/04/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
gi|229396427_A/California/08/2      SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL 500
                                    **************************************************

gi|237511877_A/Mexico/4603/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511887_A/Mexico/4482/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229484063_A/Canada-NS/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892778_A/Canada-NS/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237624325_A/swine/Alberta/O      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831785_A/California/06/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831770_A/California/05/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229536083_A/Indiana/09/2009      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229783410_A/New_York/1682/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229783389_A/New_York/1669/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892772_A/Canada-NS/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511881_A/Mexico/4486/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511889_A/Mexico/4108/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|237511879_A/Mexico/4604/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892776_A/Canada-AB/RV153      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892782_A/Canada-ON/RV152      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892774_A/Canada-ON/RV152      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229892780_A/Mexico/InDRE411      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229535826_A/California/14/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229536113_A/Michigan/02/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229536127_A/New_York/13/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229535979_A/Texas/08/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229535808_A/Texas/09/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229484067_A/Canada-ON/RV152      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229484065_A/Mexico/InDRE448      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396441_A/New_York/10/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396379_A/New_York/11/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396455_A/New_York/15/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396397_A/New_York/18/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396408_A/New_York/31/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396485_A/New_York/19/200      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396502_A/Ohio/07/2009         YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977134_A/Texas/04/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229299530_A/Texas/04/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831799_A/Texas/05/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229299510_A/Texas/05/2009        YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977170_A/California/07/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977146_A/California/07/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227831815_A/California/07/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227977114_A/California/04/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|227809828_A/California/04/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
gi|229396427_A/California/08/2      YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL 550
                                    **************************************************

gi|237511877_A/Mexico/4603/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|237511887_A/Mexico/4482/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229484063_A/Canada-NS/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229892778_A/Canada-NS/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237624325_A/swine/Alberta/O      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|227831785_A/California/06/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|227831770_A/California/05/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229536083_A/Indiana/09/2009      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229783410_A/New_York/1682/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229783389_A/New_York/1669/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|229892772_A/Canada-NS/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237511881_A/Mexico/4486/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237511889_A/Mexico/4108/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMELRRCLLQSLQQIESMIEAES 600
gi|237511879_A/Mexico/4604/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892776_A/Canada-AB/RV153      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892782_A/Canada-ON/RV152      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892774_A/Canada-ON/RV152      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229892780_A/Mexico/InDRE411      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229535826_A/California/14/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229536113_A/Michigan/02/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229536127_A/New_York/13/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229535979_A/Texas/08/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229535808_A/Texas/09/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229484067_A/Canada-ON/RV152      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229484065_A/Mexico/InDRE448      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396441_A/New_York/10/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396379_A/New_York/11/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396455_A/New_York/15/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396397_A/New_York/18/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396408_A/New_York/31/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396485_A/New_York/19/200      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396502_A/Ohio/07/2009         RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977134_A/Texas/04/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229299530_A/Texas/04/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227831799_A/Texas/05/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229299510_A/Texas/05/2009        RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977170_A/California/07/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977146_A/California/07/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227831815_A/California/07/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227977114_A/California/04/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|227809828_A/California/04/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
gi|229396427_A/California/08/2      RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES 600
                                    ******************************:*******************

gi|237511877_A/Mexico/4603/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511887_A/Mexico/4482/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229484063_A/Canada-NS/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892778_A/Canada-NS/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237624325_A/swine/Alberta/O      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831785_A/California/06/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831770_A/California/05/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229536083_A/Indiana/09/2009      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229783410_A/New_York/1682/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229783389_A/New_York/1669/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892772_A/Canada-NS/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511881_A/Mexico/4486/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511889_A/Mexico/4108/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|237511879_A/Mexico/4604/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892776_A/Canada-AB/RV153      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892782_A/Canada-ON/RV152      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892774_A/Canada-ON/RV152      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229892780_A/Mexico/InDRE411      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229535826_A/California/14/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229536113_A/Michigan/02/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229536127_A/New_York/13/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229535979_A/Texas/08/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229535808_A/Texas/09/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229484067_A/Canada-ON/RV152      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229484065_A/Mexico/InDRE448      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396441_A/New_York/10/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396379_A/New_York/11/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396455_A/New_York/15/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396397_A/New_York/18/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396408_A/New_York/31/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396485_A/New_York/19/200      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396502_A/Ohio/07/2009         SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977134_A/Texas/04/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229299530_A/Texas/04/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831799_A/Texas/05/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229299510_A/Texas/05/2009        SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977170_A/California/07/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977146_A/California/07/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227831815_A/California/07/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227977114_A/California/04/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|227809828_A/California/04/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
gi|229396427_A/California/08/2      SVKEKDMTKEFFENKSETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLY 650
                                    **************************************************

gi|237511877_A/Mexico/4603/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511887_A/Mexico/4482/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229484063_A/Canada-NS/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892778_A/Canada-NS/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237624325_A/swine/Alberta/O      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831785_A/California/06/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831770_A/California/05/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229536083_A/Indiana/09/2009      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229783410_A/New_York/1682/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229783389_A/New_York/1669/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892772_A/Canada-NS/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511881_A/Mexico/4486/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511889_A/Mexico/4108/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|237511879_A/Mexico/4604/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892776_A/Canada-AB/RV153      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892782_A/Canada-ON/RV152      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892774_A/Canada-ON/RV152      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229892780_A/Mexico/InDRE411      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229535826_A/California/14/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229536113_A/Michigan/02/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229536127_A/New_York/13/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229535979_A/Texas/08/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229535808_A/Texas/09/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229484067_A/Canada-ON/RV152      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229484065_A/Mexico/InDRE448      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396441_A/New_York/10/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396379_A/New_York/11/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396455_A/New_York/15/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396397_A/New_York/18/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396408_A/New_York/31/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396485_A/New_York/19/200      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396502_A/Ohio/07/2009         ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977134_A/Texas/04/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229299530_A/Texas/04/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831799_A/Texas/05/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229299510_A/Texas/05/2009        ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977170_A/California/07/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977146_A/California/07/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227831815_A/California/07/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227977114_A/California/04/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|227809828_A/California/04/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
gi|229396427_A/California/08/2      ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV 700
                                    **************************************************

gi|237511877_A/Mexico/4603/200      LLNASWFNSFLTHALK 716
gi|237511887_A/Mexico/4482/200      LLNASWFNSFLTHALK 716
gi|229484063_A/Canada-NS/RV153      LLNASWFNSFLTHALK 716
gi|229892778_A/Canada-NS/RV153      LLNASWFNSFLTHALK 716
gi|237624325_A/swine/Alberta/O      LPNASWFNSFLTHALK 716
gi|227831785_A/California/06/2      LLNASWFNSFLTHALK 716
gi|227831770_A/California/05/2      LLNASWFNSFLTHALK 716
gi|229536083_A/Indiana/09/2009      LLNASWFNSFLTHALK 716
gi|229783410_A/New_York/1682/2      LLNASWFNSFLTHALK 716
gi|229783389_A/New_York/1669/2      LLNASWFNSFLTHALK 716
gi|229892772_A/Canada-NS/RV153      LLNASWFNSFLTHALK 716
gi|237511881_A/Mexico/4486/200      LLNASWFNSFLTHALK 716
gi|237511889_A/Mexico/4108/200      LLNASWFNSFLTHALK 716
gi|237511879_A/Mexico/4604/200      LLNASWFNSFLTHALK 716
gi|229892776_A/Canada-AB/RV153      LLNASWFNSFLTHALK 716
gi|229892782_A/Canada-ON/RV152      LLNASWFNSFLTHALK 716
gi|229892774_A/Canada-ON/RV152      LLNASWFNSFLTHALK 716
gi|229892780_A/Mexico/InDRE411      LLNASWFNSFLTHALK 716
gi|229535826_A/California/14/2      LLNASWFNSFLTHALK 716
gi|229536113_A/Michigan/02/200      LLNASWFNSFLTHALK 716
gi|229536127_A/New_York/13/200      LLNASWFNSFLTHALK 716
gi|229535979_A/Texas/08/2009        LLNASWFNSFLTHALK 716
gi|229535808_A/Texas/09/2009        LLNASWFNSFLTHALK 716
gi|229484067_A/Canada-ON/RV152      LLNASWFNSFLTHALK 716
gi|229484065_A/Mexico/InDRE448      LLNASWFNSFLTHALK 716
gi|229396441_A/New_York/10/200      LLNASWFNSFLTHALK 716
gi|229396379_A/New_York/11/200      LLNASWFNSFLTHALK 716
gi|229396455_A/New_York/15/200      LLNASWFNSFLTHALK 716
gi|229396397_A/New_York/18/200      LLNASWFNSFLTHALK 716
gi|229396408_A/New_York/31/200      LLNASWFNSFLTHALK 716
gi|229396485_A/New_York/19/200      LLNASWFNSFLTHALK 716
gi|229396502_A/Ohio/07/2009         LLNASWFNSFLTHALK 716
gi|227977134_A/Texas/04/2009        LLNASWFNSFLTHALK 716
gi|229299530_A/Texas/04/2009        LLNASWFNSFLTHALK 716
gi|227831799_A/Texas/05/2009        LLNASWFNSFLTHALK 716
gi|229299510_A/Texas/05/2009        LLNASWFNSFLTHALK 716
gi|227977170_A/California/07/2      LLNASWFNSFLTHALK 716
gi|227977146_A/California/07/2      LLNASWFNSFLTHALK 716
gi|227831815_A/California/07/2      LLNASWFNSFLTHALK 716
gi|227977114_A/California/04/2      LLNASWFNSFLTHALK 716
gi|227809828_A/California/04/2      LLNASWFNSFLTHALK 716
gi|229396427_A/California/08/2      LLNASWFNSFLTHALK 716
* **************

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools