User:Michael Strong/H1N1/PB2

From Proteopedia

Jump to: navigation, search

home H1N1 PB2 PB1 PA HA NP NA MP NS

Contents

Protein Structural Homolgy Model

PB2 Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009 PB2, residues 535-742, 95% sequence identity to pdp template 3cw4

Sequence Polymorphisms

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
PB2 I30V 229892696_A/Canada-AB/RV153 1
PB2 N82S 229484025_A/Mexico/InDRE448 all others
PB2 H151Q 237624321_A/swine/Alberta/O 1
PB2 D161N 227831783_A/California/06/2 1
PB2 V267I 229783414_A/New_York/1682/2 1
PB2 S324R 237624321_A/swine/Alberta/O 1
PB2 H432Y 237624321_A/swine/Alberta/O 1
PB2 L464M 229892692_A/Mexico/InDRE411 1
PB2 K526R 229892698_A/Canada-NS/RV153 5
PB2 G698D 227831783_A/California/06/2 1

Multiple Sequence Alignment

H1N1 Swine Flu Multiple Sequence Alignment of PB2 Protein, 31 sequences

gi|229892698_A/Canada-NS/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|237511929_A/Mexico/4486/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229576678_A/Canada-NS/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229783393_A/New_York/1669/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892688_A/Canada-NS/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227977136_A/Texas/04/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229396471_A/California/07/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227977148_A/California/07/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227831813_A/California/07/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227831766_A/California/05/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227977116_A/California/04/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227809824_A/California/04/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229396421_A/California/08/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229396391_A/New_York/18/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229484023_A/Canada-ON/RV152      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535803_A/Texas/09/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535975_A/Texas/08/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229536070_A/Texas/07/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535790_A/New_York/22/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229536028_A/Minnesota/02/20      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535822_A/California/14/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229536042_A/Arizona/02/2009      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892694_A/Canada-ON/RV152      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892690_A/Canada-ON/RV152      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|237511931_A/Mexico/4604/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892696_A/Canada-AB/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAVIKKYTSGRQEKNPALRMKWM 50
gi|229783414_A/New_York/1682/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892692_A/Mexico/InDRE411      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229484025_A/Mexico/InDRE448      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227831783_A/California/06/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|237624321_A/swine/Alberta/O      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
                                    *****************************:********************

gi|229892698_A/Canada-NS/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|237511929_A/Mexico/4486/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229576678_A/Canada-NS/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229783393_A/New_York/1669/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892688_A/Canada-NS/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227977136_A/Texas/04/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229396471_A/California/07/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227977148_A/California/07/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227831813_A/California/07/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227831766_A/California/05/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227977116_A/California/04/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227809824_A/California/04/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229396421_A/California/08/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229396391_A/New_York/18/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229484023_A/Canada-ON/RV152      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535803_A/Texas/09/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535975_A/Texas/08/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229536070_A/Texas/07/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535790_A/New_York/22/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229536028_A/Minnesota/02/20      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535822_A/California/14/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229536042_A/Arizona/02/2009      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892694_A/Canada-ON/RV152      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892690_A/Canada-ON/RV152      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|237511931_A/Mexico/4604/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892696_A/Canada-AB/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229783414_A/New_York/1682/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892692_A/Mexico/InDRE411      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229484025_A/Mexico/InDRE448      MAMRYPITADKRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWN 100
gi|227831783_A/California/06/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|237624321_A/swine/Alberta/O      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
                                    *******************************.******************

gi|229892698_A/Canada-NS/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|237511929_A/Mexico/4486/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229576678_A/Canada-NS/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229783393_A/New_York/1669/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892688_A/Canada-NS/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227977136_A/Texas/04/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229396471_A/California/07/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227977148_A/California/07/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227831813_A/California/07/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227831766_A/California/05/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227977116_A/California/04/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227809824_A/California/04/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229396421_A/California/08/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229396391_A/New_York/18/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229484023_A/Canada-ON/RV152      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535803_A/Texas/09/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535975_A/Texas/08/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229536070_A/Texas/07/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535790_A/New_York/22/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229536028_A/Minnesota/02/20      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535822_A/California/14/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229536042_A/Arizona/02/2009      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892694_A/Canada-ON/RV152      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892690_A/Canada-ON/RV152      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|237511931_A/Mexico/4604/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892696_A/Canada-AB/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229783414_A/New_York/1682/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892692_A/Mexico/InDRE411      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229484025_A/Mexico/InDRE448      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227831783_A/California/06/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|237624321_A/swine/Alberta/O      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|237511929_A/Mexico/4486/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229576678_A/Canada-NS/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229783393_A/New_York/1669/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892688_A/Canada-NS/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227977136_A/Texas/04/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229396471_A/California/07/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227977148_A/California/07/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227831813_A/California/07/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227831766_A/California/05/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227977116_A/California/04/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227809824_A/California/04/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229396421_A/California/08/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229396391_A/New_York/18/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229484023_A/Canada-ON/RV152      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535803_A/Texas/09/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535975_A/Texas/08/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229536070_A/Texas/07/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535790_A/New_York/22/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229536028_A/Minnesota/02/20      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535822_A/California/14/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229536042_A/Arizona/02/2009      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892694_A/Canada-ON/RV152      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892690_A/Canada-ON/RV152      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|237511931_A/Mexico/4604/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892696_A/Canada-AB/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229783414_A/New_York/1682/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892692_A/Mexico/InDRE411      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229484025_A/Mexico/InDRE448      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227831783_A/California/06/2      HADLSAKEAQNVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|237624321_A/swine/Alberta/O      QADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
                                    :*********:***************************************

gi|229892698_A/Canada-NS/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|237511929_A/Mexico/4486/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229576678_A/Canada-NS/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229783393_A/New_York/1669/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892688_A/Canada-NS/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227977136_A/Texas/04/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229396471_A/California/07/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227977148_A/California/07/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227831813_A/California/07/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227831766_A/California/05/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227977116_A/California/04/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227809824_A/California/04/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229396421_A/California/08/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229396391_A/New_York/18/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229484023_A/Canada-ON/RV152      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535803_A/Texas/09/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535975_A/Texas/08/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229536070_A/Texas/07/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535790_A/New_York/22/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229536028_A/Minnesota/02/20      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535822_A/California/14/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229536042_A/Arizona/02/2009      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892694_A/Canada-ON/RV152      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892690_A/Canada-ON/RV152      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|237511931_A/Mexico/4604/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892696_A/Canada-AB/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229783414_A/New_York/1682/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892692_A/Mexico/InDRE411      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229484025_A/Mexico/InDRE448      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227831783_A/California/06/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|237624321_A/swine/Alberta/O      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|237511929_A/Mexico/4486/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229576678_A/Canada-NS/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229783393_A/New_York/1669/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892688_A/Canada-NS/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227977136_A/Texas/04/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229396471_A/California/07/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227977148_A/California/07/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227831813_A/California/07/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227831766_A/California/05/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227977116_A/California/04/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227809824_A/California/04/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229396421_A/California/08/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229396391_A/New_York/18/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229484023_A/Canada-ON/RV152      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535803_A/Texas/09/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535975_A/Texas/08/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229536070_A/Texas/07/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535790_A/New_York/22/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229536028_A/Minnesota/02/20      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535822_A/California/14/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229536042_A/Arizona/02/2009      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892694_A/Canada-ON/RV152      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892690_A/Canada-ON/RV152      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|237511931_A/Mexico/4604/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892696_A/Canada-AB/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229783414_A/New_York/1682/2      RNDDVDQSLIIAARNIIRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892692_A/Mexico/InDRE411      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229484025_A/Mexico/InDRE448      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227831783_A/California/06/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|237624321_A/swine/Alberta/O      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
                                    ****************:*********************************

gi|229892698_A/Canada-NS/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|237511929_A/Mexico/4486/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229576678_A/Canada-NS/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229783393_A/New_York/1669/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892688_A/Canada-NS/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227977136_A/Texas/04/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229396471_A/California/07/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227977148_A/California/07/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227831813_A/California/07/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227831766_A/California/05/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227977116_A/California/04/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227809824_A/California/04/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229396421_A/California/08/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229396391_A/New_York/18/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229484023_A/Canada-ON/RV152      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535803_A/Texas/09/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535975_A/Texas/08/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229536070_A/Texas/07/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535790_A/New_York/22/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229536028_A/Minnesota/02/20      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535822_A/California/14/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229536042_A/Arizona/02/2009      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892694_A/Canada-ON/RV152      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892690_A/Canada-ON/RV152      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|237511931_A/Mexico/4604/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892696_A/Canada-AB/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229783414_A/New_York/1682/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892692_A/Mexico/InDRE411      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229484025_A/Mexico/InDRE448      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227831783_A/California/06/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|237624321_A/swine/Alberta/O      NPTEEQAVDICKAAIGLRISSSFRFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
                                    *********************** **************************

gi|229892698_A/Canada-NS/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|237511929_A/Mexico/4486/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229576678_A/Canada-NS/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229783393_A/New_York/1669/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892688_A/Canada-NS/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227977136_A/Texas/04/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229396471_A/California/07/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227977148_A/California/07/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227831813_A/California/07/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227831766_A/California/05/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227977116_A/California/04/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227809824_A/California/04/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229396421_A/California/08/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229396391_A/New_York/18/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229484023_A/Canada-ON/RV152      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535803_A/Texas/09/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535975_A/Texas/08/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229536070_A/Texas/07/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535790_A/New_York/22/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229536028_A/Minnesota/02/20      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535822_A/California/14/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229536042_A/Arizona/02/2009      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892694_A/Canada-ON/RV152      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892690_A/Canada-ON/RV152      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|237511931_A/Mexico/4604/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892696_A/Canada-AB/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229783414_A/New_York/1682/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892692_A/Mexico/InDRE411      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229484025_A/Mexico/InDRE448      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227831783_A/California/06/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|237624321_A/swine/Alberta/O      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|237511929_A/Mexico/4486/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229576678_A/Canada-NS/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229783393_A/New_York/1669/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892688_A/Canada-NS/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227977136_A/Texas/04/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229396471_A/California/07/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227977148_A/California/07/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227831813_A/California/07/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227831766_A/California/05/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227977116_A/California/04/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227809824_A/California/04/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229396421_A/California/08/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229396391_A/New_York/18/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229484023_A/Canada-ON/RV152      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535803_A/Texas/09/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535975_A/Texas/08/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229536070_A/Texas/07/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535790_A/New_York/22/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229536028_A/Minnesota/02/20      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535822_A/California/14/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229536042_A/Arizona/02/2009      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892694_A/Canada-ON/RV152      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892690_A/Canada-ON/RV152      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|237511931_A/Mexico/4604/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892696_A/Canada-AB/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229783414_A/New_York/1682/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892692_A/Mexico/InDRE411      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229484025_A/Mexico/InDRE448      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227831783_A/California/06/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|237624321_A/swine/Alberta/O      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMYQLLRHFQKDAKVLFQNWG 450
                                    *******************************:******************

gi|229892698_A/Canada-NS/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|237511929_A/Mexico/4486/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229576678_A/Canada-NS/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229783393_A/New_York/1669/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892688_A/Canada-NS/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227977136_A/Texas/04/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229396471_A/California/07/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227977148_A/California/07/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227831813_A/California/07/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227831766_A/California/05/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227977116_A/California/04/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227809824_A/California/04/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229396421_A/California/08/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229396391_A/New_York/18/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229484023_A/Canada-ON/RV152      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535803_A/Texas/09/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535975_A/Texas/08/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229536070_A/Texas/07/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535790_A/New_York/22/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229536028_A/Minnesota/02/20      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535822_A/California/14/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229536042_A/Arizona/02/2009      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892694_A/Canada-ON/RV152      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892690_A/Canada-ON/RV152      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|237511931_A/Mexico/4604/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892696_A/Canada-AB/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229783414_A/New_York/1682/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892692_A/Mexico/InDRE411      IESIDNVMGMIGIMPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229484025_A/Mexico/InDRE448      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227831783_A/California/06/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|237624321_A/swine/Alberta/O      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
                                    *************:************************************

gi|229892698_A/Canada-NS/RV153      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|237511929_A/Mexico/4486/200      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|229576678_A/Canada-NS/RV153      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|229783393_A/New_York/1669/2      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|229892688_A/Canada-NS/RV153      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|227977136_A/Texas/04/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229396471_A/California/07/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227977148_A/California/07/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227831813_A/California/07/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227831766_A/California/05/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227977116_A/California/04/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227809824_A/California/04/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229396421_A/California/08/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229396391_A/New_York/18/200      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229484023_A/Canada-ON/RV152      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535803_A/Texas/09/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535975_A/Texas/08/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229536070_A/Texas/07/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535790_A/New_York/22/200      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229536028_A/Minnesota/02/20      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535822_A/California/14/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229536042_A/Arizona/02/2009      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892694_A/Canada-ON/RV152      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892690_A/Canada-ON/RV152      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|237511931_A/Mexico/4604/200      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892696_A/Canada-AB/RV153      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229783414_A/New_York/1682/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892692_A/Mexico/InDRE411      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229484025_A/Mexico/InDRE448      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227831783_A/California/06/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|237624321_A/swine/Alberta/O      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
                                    *************************:************************

gi|229892698_A/Canada-NS/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|237511929_A/Mexico/4486/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229576678_A/Canada-NS/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229783393_A/New_York/1669/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892688_A/Canada-NS/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227977136_A/Texas/04/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229396471_A/California/07/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227977148_A/California/07/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227831813_A/California/07/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227831766_A/California/05/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227977116_A/California/04/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227809824_A/California/04/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229396421_A/California/08/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229396391_A/New_York/18/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229484023_A/Canada-ON/RV152      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535803_A/Texas/09/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535975_A/Texas/08/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229536070_A/Texas/07/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535790_A/New_York/22/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229536028_A/Minnesota/02/20      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535822_A/California/14/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229536042_A/Arizona/02/2009      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892694_A/Canada-ON/RV152      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892690_A/Canada-ON/RV152      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|237511931_A/Mexico/4604/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892696_A/Canada-AB/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229783414_A/New_York/1682/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892692_A/Mexico/InDRE411      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229484025_A/Mexico/InDRE448      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227831783_A/California/06/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|237624321_A/swine/Alberta/O      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|237511929_A/Mexico/4486/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229576678_A/Canada-NS/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229783393_A/New_York/1669/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892688_A/Canada-NS/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227977136_A/Texas/04/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229396471_A/California/07/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227977148_A/California/07/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227831813_A/California/07/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227831766_A/California/05/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227977116_A/California/04/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227809824_A/California/04/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229396421_A/California/08/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229396391_A/New_York/18/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229484023_A/Canada-ON/RV152      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535803_A/Texas/09/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535975_A/Texas/08/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229536070_A/Texas/07/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535790_A/New_York/22/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229536028_A/Minnesota/02/20      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535822_A/California/14/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229536042_A/Arizona/02/2009      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892694_A/Canada-ON/RV152      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892690_A/Canada-ON/RV152      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|237511931_A/Mexico/4604/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892696_A/Canada-AB/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229783414_A/New_York/1682/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892692_A/Mexico/InDRE411      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229484025_A/Mexico/InDRE448      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227831783_A/California/06/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|237624321_A/swine/Alberta/O      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|237511929_A/Mexico/4486/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229576678_A/Canada-NS/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229783393_A/New_York/1669/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892688_A/Canada-NS/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227977136_A/Texas/04/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229396471_A/California/07/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227977148_A/California/07/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227831813_A/California/07/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227831766_A/California/05/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227977116_A/California/04/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227809824_A/California/04/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229396421_A/California/08/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229396391_A/New_York/18/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229484023_A/Canada-ON/RV152      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535803_A/Texas/09/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535975_A/Texas/08/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229536070_A/Texas/07/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535790_A/New_York/22/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229536028_A/Minnesota/02/20      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535822_A/California/14/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229536042_A/Arizona/02/2009      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892694_A/Canada-ON/RV152      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892690_A/Canada-ON/RV152      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|237511931_A/Mexico/4604/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892696_A/Canada-AB/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229783414_A/New_York/1682/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892692_A/Mexico/InDRE411      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229484025_A/Mexico/InDRE448      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227831783_A/California/06/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILDKE 700
gi|237624321_A/swine/Alberta/O      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
                                    ***********************************************.**

gi|229892698_A/Canada-NS/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|237511929_A/Mexico/4486/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229576678_A/Canada-NS/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229783393_A/New_York/1669/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892688_A/Canada-NS/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227977136_A/Texas/04/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229396471_A/California/07/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227977148_A/California/07/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227831813_A/California/07/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227831766_A/California/05/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227977116_A/California/04/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227809824_A/California/04/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229396421_A/California/08/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229396391_A/New_York/18/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229484023_A/Canada-ON/RV152      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535803_A/Texas/09/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535975_A/Texas/08/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229536070_A/Texas/07/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535790_A/New_York/22/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229536028_A/Minnesota/02/20      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535822_A/California/14/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229536042_A/Arizona/02/2009      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892694_A/Canada-ON/RV152      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892690_A/Canada-ON/RV152      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|237511931_A/Mexico/4604/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892696_A/Canada-AB/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229783414_A/New_York/1682/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892692_A/Mexico/InDRE411      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229484025_A/Mexico/InDRE448      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227831783_A/California/06/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|237624321_A/swine/Alberta/O      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      TKRIRMAIN 759
gi|237511929_A/Mexico/4486/200      TKRIR---- 755
gi|229576678_A/Canada-NS/RV153      TKRIRMAIN 759
gi|229783393_A/New_York/1669/2      TKRIRMAIN 759
gi|229892688_A/Canada-NS/RV153      TKRIRMAIN 759
gi|227977136_A/Texas/04/2009        TKRIRMAIN 759
gi|229396471_A/California/07/2      TKRIRMAIN 759
gi|227977148_A/California/07/2      TKRIRMAIN 759
gi|227831813_A/California/07/2      TKRIRMAIN 759
gi|227831766_A/California/05/2      TKRIRMAIN 759
gi|227977116_A/California/04/2      TKRIRMAIN 759
gi|227809824_A/California/04/2      TKRIRMAIN 759
gi|229396421_A/California/08/2      TKRIRMAIN 759
gi|229396391_A/New_York/18/200      TKRIRMAIN 759
gi|229484023_A/Canada-ON/RV152      TKRIRMAIN 759
gi|229535803_A/Texas/09/2009        TKRIRMAIN 759
gi|229535975_A/Texas/08/2009        TKRIRMAIN 759
gi|229536070_A/Texas/07/2009        TKRIRMAIN 759
gi|229535790_A/New_York/22/200      TKRIRMAIN 759
gi|229536028_A/Minnesota/02/20      TKRIRMAIN 759
gi|229535822_A/California/14/2      TKRIRMAIN 759
gi|229536042_A/Arizona/02/2009      TKRIRMAIN 759
gi|229892694_A/Canada-ON/RV152      TKRIRMAIN 759
gi|229892690_A/Canada-ON/RV152      TKRIRMAIN 759
gi|237511931_A/Mexico/4604/200      TKRIRMAIN 759
gi|229892696_A/Canada-AB/RV153      TKRIRMAIN 759
gi|229783414_A/New_York/1682/2      TKRIRMAIN 759
gi|229892692_A/Mexico/InDRE411      TKRIRMAIN 759
gi|229484025_A/Mexico/InDRE448      TKRIRMAIN 759
gi|227831783_A/California/06/2      TKRIRMAIN 759
gi|237624321_A/swine/Alberta/O      TKRIRMAIN 759
                                    *****    


BLAST

>gb|ABC59716.1|  polymerase PB2 [Influenza A virus (A/turkey/Ohio/313053/04(H3N2))]
 gb|ABF18002.1|  polymerase subunit PB2 [Influenza A virus (A/Ontario/RV1273/2005(H3N2))]
 gb|ABF18004.1|  polymerase subunit PB2 [Influenza A virus (A/swine/British Columbia/28103/2005(H3N2))]
 gb|ABF18006.1|  polymerase subunit PB2 [Influenza A virus (A/swine/Ontario/33853/2005(H3N2))]
 gb|ABF18007.1|  polymerase subunit PB2 [Influenza A virus (A/turkey/Ontario/31232/2005(H3N2))]
 gb|ACD88669.1|  polymerase PB2 [Influenza A virus (A/turkey/OH/313053/2004(H3N2))]
Length=759

 Score = 1553 bits (4022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/759 (98%), Positives = 756/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78134.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/PZ7/2006(H1N2))]
 gb|ACE78135.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/PZ14/2006(H1N2))]
Length=759

 Score = 1553 bits (4020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
             TKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  TTKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABY81853.2|  polymerase PB2 [Influenza A virus (A/swine/Korea/JNS06/2004(H3N2))]
Length=759

 Score = 1552 bits (4019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL IT+EKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITREKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGMRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPS EMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSMEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGD+VLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDIVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78127.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CAS08/2005(H1N1))]
Length=759

 Score = 1552 bits (4019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPT STVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTASTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDA+VLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDARVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVL+NTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLINTYQWIIRNWESVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAO65605.1|  polymerase subunit PB2 [Influenza A virus (A/duck/NC/91347/01(H1N2))]
Length=759

 Score = 1552 bits (4019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVV SIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVASIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSL PKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLFPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGAL EDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALAEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACD88658.1|  polymerase PB2 [Influenza A virus (A/turkey/NC/353568/2005(H3N2))]
Length=759

 Score = 1552 bits (4018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 756/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNK+EFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKIEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78137.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CAS05/2004(H3N2))]
Length=759

 Score = 1551 bits (4016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 756/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDR+MVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRLMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQ+KIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQIKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFT+VGRRATAILRKATRRLIQLIVSGRDEQS+AEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTIVGRRATAILRKATRRLIQLIVSGRDEQSVAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTV+VRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVSVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78130.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/JL02/2005(H1N2))]
Length=759

 Score = 1551 bits (4016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAK LFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKALFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
             TKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  TTKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78128.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2))]
Length=759

 Score = 1551 bits (4016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDA+VLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDARVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATR RYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRGRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABA27429.1|  polymerase [Influenza A virus (A/swine/MI/PU243/04 (H3N1))]
Length=759

 Score = 1551 bits (4016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIA RNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIATRNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF04401.1|  polymerase PB2 [Influenza A virus (A/swine/Quebec/4001/2005(H3N2))]
Length=759

 Score = 1551 bits (4015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRD RGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDLRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAL87931.1|AF455733_1  polymerase subunit [Influenza A virus (A/Swine/North Carolina/93523/01 
(H1N2))]
Length=759

 Score = 1551 bits (4015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM MIPERNEQGQTLWSKT+DAGS+RVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMGMIPERNEQGQTLWSKTNDAGSERVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEE+LTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEMLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLA+GE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLARGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI54402.1|  polymerase basic protein 2 [Influenza A virus (A/swine/Korea/PZ72-1/2006(H3N1))]
Length=759

 Score = 1550 bits (4014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLS KEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSPKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVR LF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRALF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAL87935.1|AF455737_1  polymerase subunit [Influenza A virus (A/Swine/Illinois/100085A/01 
(H1N2))]
Length=759

 Score = 1550 bits (4014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVY EVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYNEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYT GGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTSGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACI48761.1|  polymerase PB2 [Influenza A virus (A/swine/Shanghai/1/2007(H1N2))]
Length=759

 Score = 1550 bits (4012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAII+KYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIRKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHG FGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGAFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEE+LTGNLQTLK+RVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEMLTGNLQTLKMRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEE+SETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEISETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFA+APPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFASAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78143.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CY07/2007(H3N2))]
Length=759

 Score = 1550 bits (4012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGMRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQED MIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDRMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVL+NTYQW+IRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLINTYQWVIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGD+VLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDIVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78140.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CAS09/2006(H3N2))]
Length=759

 Score = 1549 bits (4011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGMRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEA+IVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAVIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTE+SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEISLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWS DPTMLYNKMEFEPFQSLVPKA RSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSHDPTMLYNKMEFEPFQSLVPKAIRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGD+VLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDIVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF25539.1|  polymerase PB2 [Influenza A virus (A/turkey/MN/366767/2005(H3N2))]
Length=759

 Score = 1549 bits (4011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 756/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLW+KT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWNKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            +TKRLT+LGK+AGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  STKRLTILGKNAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF25468.1|  polymerase PB2 [Influenza A virus (A/blue winged teal/LA/B228/1986(H1N1))]
Length=759

 Score = 1549 bits (4011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACD65210.1|  polymerase PB2 [Influenza A virus (A/swine/Ohio/75004/04(H1N1))]
Length=759

 Score = 1549 bits (4010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMGMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVV+IDRFLRVRDQ+GNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVNIDRFLRVRDQQGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKA RSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWENLKIQWSQDPTMLYNKMEFEPFQSLVPKAARSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABQ41885.1|  polymerase PB2 [Influenza A virus (A/turkey/Illinois/2004(H3N2))]
Length=759

 Score = 1549 bits (4010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMD IPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDTIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGR+EQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRNEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTTGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78145.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CY10/2007(H3N2))]
Length=759

 Score = 1548 bits (4009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPT STVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTASTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGMRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQED MIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDRMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVL+NTYQW+IRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLINTYQWVIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGD+VLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDIVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABQ41895.1|  polymerase PB2 [Influenza A virus (A/swine/North Carolina/2003(H3N2))]
Length=759

 Score = 1548 bits (4009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRR+VD NPGHADLSAKEAQDVIMEVV+PNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRKVDINPGHADLSAKEAQDVIMEVVYPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVD+LRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGMRMVDLLRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGG TFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGLTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGD+VLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDIVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78142.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CY05/2007(H3N2))]
 gb|ACE78144.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CY09/2007(H3N2))]
Length=759

 Score = 1548 bits (4008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEV+NDDVDQSLIIAARNIVRRA+VSADPLASLLEMCHSTQIGG+RMVDI+RQ
Sbjct  241  EQMYTPGGEVKNDDVDQSLIIAARNIVRRASVSADPLASLLEMCHSTQIGGIRMVDIIRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEE+LTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEMLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNK+EFEPFQSLVPKATR+RYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKIEFEPFQSLVPKATRNRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDS TATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSHTATKRIRMAIN  759


>gb|ABL67043.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/324/1988(H4N6))]
Length=759

 Score = 1548 bits (4008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAL87930.1|AF455732_1  polymerase subunit [Influenza A virus (A/Swine/North Carolina/98225/01(H1N2))]
Length=759

 Score = 1548 bits (4008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/759 (98%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGP TSTVHYPKVYKTYFE
Sbjct  61   KRIMGMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPATSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS YIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSGYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGAL EDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALIEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19801.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/25/1985(H4N6))]
 gb|ABI84430.1|  polymerase PB2 [Influenza A virus (A/mallard/Alberta/7/1987(H8N4))]
Length=759

 Score = 1548 bits (4008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF04391.1|  polymerase PB2 [Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2))]
Length=759

 Score = 1548 bits (4007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 755/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPL+VAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLIVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAA+SADPL+SLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAALSADPLSSLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTFLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAL87929.1|AF455731_1  polymerase subunit [Influenza A virus (A/Swine/Ohio/891/01(H1N2))]
Length=759

 Score = 1548 bits (4007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKE+LQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEDLQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGG+VRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGDVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTML  KMEFEPFQSLVPKA RSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLSTKMEFEPFQSLVPKAARSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI54403.1|  polymerase basic protein 2 [Influenza A virus (A/swine/Korea/CN22/2006(H3N1))]
Length=759

 Score = 1547 bits (4006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLS KEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSPKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLS EEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSSEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNK+EFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKLEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB87636.1|  polymerase PB2 [Influenza A virus (A/pintail duck/ALB/623/1985(H4N6))]
Length=759

 Score = 1547 bits (4005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RM+DILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMIDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKAT+RLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATKRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19945.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/435/1985(H7N3))]
 gb|ABB87677.1|  polymerase PB2 [Influenza A virus (A/blue-winged teal/ALB/293/1994(H4N6))]
 gb|ABB87699.1|  polymerase PB2 [Influenza A virus (A/blue-winged teal/Alberta/293/2003(H4N6))]
 8 more sequence titles
 gb|ABI20814.1|  polymerase PB2 [Influenza A virus (A/pintail/Ohio/226/1998(H6N2))]
 gb|ABI84385.1|  polymerase PB2 [Influenza A virus (A/mallard duck/Alberta/323/1988(H2N1))]
 gb|ABI84410.1|  polymerase PB2 [Influenza A virus (A/mallard duck/Alberta/331/1985(H3N6))]
 gb|ABJ09106.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/264/1986(H3N8))]
 gb|ABO52026.1|  polymerase PB2 [Influenza A virus (A/pintail/Ohio/73/1989(H6N2))]
 gb|ABO52059.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/217/1998(H6N8))]
 gb|ACE81732.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF611/2007(H11N9))]
 gb|ACF47460.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF1367/2007(H3N7))]
Length=759

 Score = 1547 bits (4005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78133.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/PZ4/2006(H1N2))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYK YFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKIYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGH+DLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHSDLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKI VHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIIVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
             TKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  TTKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE76632.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF979/2007(H3N3))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO76945.1|  polymerase PB2 [Influenza A virus (A/blue-winged teal/Ohio/96/1993(H11N9))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGGVRMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGVRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI95216.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/322/1998(H7N3))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDT+QIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTIQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI92191.1|  polymerase PB2 [Influenza A virus (A/black duck/Ohio/95/1993(H1N1))]
 gb|ABM21970.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/118/1993(H1N1))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABG88233.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/298/1987(H4N6))]
 gb|ABO52147.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/568/1987(H11N9))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTST+HYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTIHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB17766.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/353/1988(H2N3))]
 gb|ABB20068.1|  polymerase PB2 [Influenza A virus (A/mallard/ALB/126/1991(H11N9))]
 gb|ABB87853.1|  polymerase PB2 [Influenza A virus (A/pintail/Alberta/129/1993(H10N7))]
 gb|ABI84733.1|  polymerase PB2 [Influenza A virus (A/mallard duck/Tennessee/11457/1985(H11N9))]
 gb|ABL67054.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/156/1990(H3N6))]
Length=759

 Score = 1546 bits (4004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABQ84731.2|  polymerase basic subunit 2 [Influenza A virus (A/wild duck/Shantou/1411/2000(H11N3))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI19006.1|  polymerase PB2 [Influenza A virus (A/Iowa/CEID23/2005(H1N1))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPT STVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTASTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKK ELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKGELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAG LT+DPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGELTKDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABS89386.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/1983/2005(H6N8))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTE+SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEISLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTED DEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDLDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABP49271.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/173/1990(H11N9))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSG+DEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGKDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI84999.1|  polymerase PB2 [Influenza A virus (A/environment/Canada/av41/2004(H7N3))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM++IPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEIIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABG88222.1|  polymerase PB2 [Influenza A virus (A/green-winged teal/Ohio/430/1987(H1N1))]
 gb|ABJ09139.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/409/1988(H12N5))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVP+A RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPRAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19857.1|  polymerase PB2 [Influenza A virus (A/mallard/ALB/49/1995(H4N6))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELR+LMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19550.1|  polymerase PB2 [Influenza A virus (A/pintail duck/ALB/238/1979(H1N1))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGGVRMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGVRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19429.1|  polymerase PB2 [Influenza A virus (A/mallard/Alberta/130/2003(H1N1))]
 gb|ABB87483.1|  polymerase PB2 [Influenza A virus (A/canvasback duck/ALB/274/1977(H4N6))]
 gb|ABB87494.1|  polymerase PB2 [Influenza A virus (A/gadwall duck/ALB/53/1977(H4N6))]
Length=759

 Score = 1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACH69549.1|  polymerase PB2 [Influenza A virus (A/swine/OH/511445/2007(H1N1))]
Length=759

 Score = 1545 bits (4001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 754/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIK LRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKGLRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRD+QSIAEAIIVA+VFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDDQSIAEAIIVAIVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABP49216.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/421/1987(H7N8))]
Length=759

 Score = 1545 bits (4001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSL+PKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLIPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI92213.1|  polymerase PB2 [Influenza A virus (A/green-winged teal/Ohio/344/1986(H4N2))]
Length=759

 Score = 1545 bits (4001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VK+QWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEAVKVQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19703.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/506/1983(H9N1))]
 gb|ABB87874.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/743/1983(H9N1))]
 gb|ABB88109.1|  polymerase PB2 [Influenza A virus (A/mallard duck/Alberta/342/1983(H12N1))]
Length=759

 Score = 1545 bits (4001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGN+LLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNILLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RIL+RGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILIRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78141.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CY04/2007(H3N2))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/758 (97%), Positives = 754/758 (99%), Gaps = 0/758 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEV+NDDVDQSLIIAARNIVRRA+VSADPLASLLEMCHSTQIGG+RMVDI+RQ
Sbjct  241  EQMYTPGGEVKNDDVDQSLIIAARNIVRRASVSADPLASLLEMCHSTQIGGIRMVDIIRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEE+LTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEMLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNK+EFEPFQSLVPKATR+RYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKIEFEPFQSLVPKATRNRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAI  758
            KANVLIGQGDVVLVMKRKRDSSILTDS TATKRIRMAI
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSHTATKRIRMAI  758


>gb|ACE81721.1|  polymerase PB2 [Influenza A virus (A/American wigeon/California/HKWF450/2007(H4N7))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO76989.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/2022/2005(H6N8))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTE+SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEVSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTED DEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDLDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO52158.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/209/1998(H11N9))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAG DRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGPDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDT+QIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTIQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABA27437.1|  polymerase [Influenza A virus (A/swine/IN/PU542/04 (H3N1))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKT VDHMAIIK+YTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTNVDHMAIIKRYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
             NRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  ANRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SK GVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKTGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB87655.1|  polymerase PB2 [Influenza A virus (A/blue-winged teal/ALB/103/1990(H4N5))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYN+
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNR  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19866.1|  polymerase PB2 [Influenza A virus (A/pintail/ALB/275/1996(H4N6))]
Length=759

 Score = 1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPT STVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTASTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQ+CKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQNCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACG59917.1|  polymerase PB2 [Influenza A virus (A/turkey/Utah/24721-10/1995(H7N3))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITK+KKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKDKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSS+KKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSIKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF47449.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF1199/2007(H3N5))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDP MLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPAMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF33760.1|  polymerase PB2 [Influenza A virus (A/green-winged teal/LA/9GW/1987(H11N9))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 740/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPT STVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTASTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL +TKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTVTKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIR+
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRI  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILG+EDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGREDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF25457.1|  polymerase PB2 [Influenza A virus (A/green-winged teal/LA/169GW/1988(H10N7))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPD+TPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDITPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE81710.1|  polymerase PB2 [Influenza A virus (A/American wigeon/California/HKWF295/2007(H6N5))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWE+N
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEVN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABU62866.1|  polymerase PB2 [Influenza A virus (A/chukar/MN/14591-7/1998(H5N2))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLA+TWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAITWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQA+DICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAIDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKAT+RLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATKRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO77055.1|  polymerase PB2 [Influenza A virus (A/turkey/Italy/1258/2005(H5N2))]
 gb|ABR37340.1|  polymerase PB2 [Influenza A virus (A/turkey/Italy/1325/2005(H5N2))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNR+GPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRSGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO52411.1|  polymerase PB2 [Influenza A virus (A/mallard/Missouri/MO130/2005(H11N3))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQLAITKEKKEELQ+CKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLAITKEKKEELQECKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSG VRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGLVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABF18005.1|  polymerase subunit PB2 [Influenza A virus (A/swine/Manitoba/12707/2005(H3N2))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSV  EVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVIYEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE ID+VMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDSVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFN NK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNSNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAL87933.1|AF455735_1  polymerase subunit [Influenza A virus (A/Swine/Iowa/930/01(H1N2))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKE+LQ+CKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEDLQNCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGG+VRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGDVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQS+AEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSVAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPST+MSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTQMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTML  KMEFEPFQSLVPKA RSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLSTKMEFEPFQSLVPKAARSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19370.1|  polymerase PB2 [Influenza A virus (A/mallard/ALB/199/1992(H6N5))]
Length=759

 Score = 1545 bits (3999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGN+LLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNILLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQW+IRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWVIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACM66729.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/233/2001(H2N3))]
 gb|ACM66751.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/231/2001(H2N3))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARN+VRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNVVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTF+TVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFETVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACM66718.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/234/2001(H2N3))]
 gb|ACM66762.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/228/2001(H2N3))]
 gb|ACM66773.1|  polymerase PB2 [Influenza A virus (A/mallard/Maryland/226/2001(H2N3))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTF+TVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFETVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78129.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/JL01/2005(H1N2))]
 gb|ACE78131.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/JL04/2005(H1N2))]
 gb|ACE78132.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/Asan04/2006(H1N2))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYK YFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKIYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGH+DLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHSDLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKI VHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIIVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDA+VLFQNWGIE IDNVMGM+GILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDARVLFQNWGIEPIDNVMGMVGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLYNKMEFEPFQSLVPKATR RYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYNKMEFEPFQSLVPKATRGRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF47427.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF1131/2007(H3N5))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPL SLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLESLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF47405.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF1046/2007(H3N5))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMI AVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMITAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF24988.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/280/1999(H3N5))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTE+SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEVSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF24921.1|  polymerase PB2 [Influenza A virus (A/chicken/New Jersey/15086-3/1994(H7N3))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGA+ILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGAKILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFL+LGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLVLGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE76533.1|  polymerase PB2 [Influenza A virus (A/northern shoveler/California/HKWF1005/2007(H10N3))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE+IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIETIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO52653.1|  polymerase PB2 [Influenza A virus (A/green-winged teal/Ohio/1289/2005(H3N8))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYN+
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNR  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABI84765.1|  polymerase PB2 [Influenza A virus (A/guinea fowl/New York/20221-11/1995(H2N2))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            K ERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KAERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRL+QLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLVQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKATRS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSR+QFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRIQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKR+TVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRITVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|AAL87936.1|AF455738_1  polymerase subunit [Influenza A virus (A/Swine/Illinois/100084/01 
(H1N2))]
Length=759

 Score = 1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNR+GPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRSGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHF+NQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFKNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSV+ EVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVHYEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYT GGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTSGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE +KIQWSQDPTMLY KMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWESLKIQWSQDPTMLYTKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78136.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CY08/2007(H1N2))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 739/759 (97%), Positives = 753/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGS+YIEVLHLTQGTCW
Sbjct  181  SQLKITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSIYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSG+DEQSI+EAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGKDEQSISEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWG E IDNVMGMIGILPDMTPSTE+SLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGTEPIDNVMGMIGILPDMTPSTEISLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEE+SETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEISETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYN+MEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNRMEFEPFQSLVPKAVRGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF25183.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/515/2000(H3N6))]
 gb|ACF33716.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/158/2000(H3N9))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNR+GPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRSGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWG+E IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGVEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABS70347.1|  polymerase PB2 [Influenza A virus (A/mallard/MD/170/2002(H1N1))]
 gb|ACF25205.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/259/1999(H3N6))]
 gb|ACF33705.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/160/1999(H4N6))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABQ84733.1|  polymerase basic subunit 2 [Influenza A virus (A/duck/Jiang Xi/1850/2005(H5N2))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 740/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSG+DEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGKDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWG+ESIDNVMGMIGILPDMTPSTEMSLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGVESIDNVMGMIGILPDMTPSTEMSLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO52565.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/94/1993(H11N3))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWS+T+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYP+VYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSRTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPRVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDVNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABL67098.1|  polymerase PB2 [Influenza A virus (A/pintail/Alaska/310/2005(H4N6))]
 gb|ACF25248.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/109/2000(H11N9))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB87450.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/635/1983(H3N5))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTE+SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEISLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTGGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB19617.1|  polymerase PB2 [Influenza A virus (A/mallard duck/ALB/322/1988(H1N1))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 743/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPP QSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPGQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABB17702.1|  polymerase PB2 [Influenza A virus (A/mallard/Alberta/884/1984(H2N5))]
Length=759

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            K+ERLKHGTFGPVHFRNQ+KIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KIERLKHGTFGPVHFRNQIKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACJ10026.1|  polymerase PB2 [Influenza A virus (A/Muscovy duck/New York/62095-1/2006(H5N2))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMY PGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYNPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYN+
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNR  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACE78126.1|  polymerase PB2 [Influenza A virus (A/swine/Korea/CAN01/2004(H1N1))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/759 (98%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIMDMIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPT STVHYPKVYKTYFE
Sbjct  61   KRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTASTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTE SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTETSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVL+NTYQWIIRNWE VKIQWSQDPTML  KMEFEPFQSLVPKATRSRYSGFVRTLF
Sbjct  541  GPESVLINTYQWIIRNWESVKIQWSQDPTMLSTKMEFEPFQSLVPKATRSRYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDV+GTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK
Sbjct  601  QQMRDVIGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAG LTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGELTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ACF33672.1|  polymerase PB2 [Influenza A virus (A/mallard/MN/113/2000(H5N2))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDD+DQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDIDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIR+HEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRIHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABS70315.1|  polymerase PB2 [Influenza A virus (A/mallard/MD/161/2002(H1N1))]
 gb|ABS70325.1|  polymerase PB2 [Influenza A virus (A/mallard/MD/163/2002(H1N1))]
 gb|ACF25150.1|  polymerase PB2 [Influenza A virus (A/mallard/MD/02-184/2002(H1N1))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+G+ESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGIESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABR37428.1|  polymerase PB2 [Influenza A virus (A/chicken/New South Wales/2/1997(H7N4))]
 gb|ABR37439.1|  polymerase PB2 [Influenza A virus (A/chicken/New South Wales/327/1997(H7N4))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLA+TWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAITWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGGVRMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGVRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRG+RV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO52092.1|  polymerase PB2 [Influenza A virus (A/longtail duck/Maryland/295/2005(H10N8))]
 gb|ABO52103.1|  polymerase PB2 [Influenza A virus (A/common scoter/Maryland/297/2005(H10N8))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVK+EEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVP+A R +YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPRAARGQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO51960.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/686/2002(H4N2))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/759 (97%), Positives = 752/759 (99%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGHADLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDIL+Q
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILKQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTE+SLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEISLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLT+LGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTILGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
            KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759


>gb|ABO51839.1|  polymerase PB2 [Influenza A virus (A/mallard/Ohio/48/1986(H3N2))]
Length=759

 Score = 1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/759 (97%), Positives = 751/759 (98%), Gaps = 0/759 (0%)

Query  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITAD  60
            MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAM+YPITAD
Sbjct  1    MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITAD  60

Query  61   KRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120
            KRIM+MIPERNEQGQTLWSKT+DAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE
Sbjct  61   KRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFE  120

Query  121  KVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSE  180
            KVERLKHGTFGPVHFRNQVKIRRRVD NPGH+DLSAKEAQDVIMEVVFPNEVGARILTSE
Sbjct  121  KVERLKHGTFGPVHFRNQVKIRRRVDINPGHSDLSAKEAQDVIMEVVFPNEVGARILTSE  180

Query  181  SQLAITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCW  240
            SQL ITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGT SVYIEVLHLTQGTCW
Sbjct  181  SQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW  240

Query  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ  300
            EQMYTPGGEVRNDDVDQSLIIAARNIVRRA VSADPLASLLEMCHSTQIGG+RMVDILRQ
Sbjct  241  EQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQ  300

Query  301  NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360
            NPTEEQAVDICKAA+GLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY
Sbjct  301  NPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQTLKIRVHEGY  360

Query  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420
            EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF
Sbjct  361  EEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNF  420

Query  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRV  480
            VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIE IDNVMGMIGILPDMTPSTEMSLRGIRV
Sbjct  421  VNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGIRV  480

Query  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540
            SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN
Sbjct  481  SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEIN  540

Query  541  GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF  600
            GPESVLVNTYQWIIRNWE VKIQWSQDPTMLYNKMEFEPFQSLVPKA RS+YSGFVRTLF
Sbjct  541  GPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARSQYSGFVRTLF  600

Query  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNK  660
            QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSG+RILVRGNSPVFNYNK
Sbjct  601  QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNK  660

Query  661  ATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720
            ATKRLTVLGKDAGALTEDPDEGT+GVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE
Sbjct  661  ATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGE  720

Query  721  KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759
             ANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Sbjct  721  MANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN  759

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools