User:Michael Strong/H1N1/PB2/MSA

From Proteopedia

Jump to: navigation, search

H1N1 Swine Flu Multiple Sequence Alignment of PB2 Protein, 31 sequences

PB2 Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009, residues 535-742, 95% sequence identity to pdp template 3cw4

Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
PB2 I30V 229892696_A/Canada-AB/RV153 1
PB2 N82S 229484025_A/Mexico/InDRE448 all others
PB2 H151Q 237624321_A/swine/Alberta/O 1
PB2 D161N 227831783_A/California/06/2 1
PB2 V267I 229783414_A/New_York/1682/2 1
PB2 S324R 237624321_A/swine/Alberta/O 1
PB2 H432Y 237624321_A/swine/Alberta/O 1
PB2 L464M 229892692_A/Mexico/InDRE411 1
PB2 K526R 229892698_A/Canada-NS/RV153 5
PB2 G698D 227831783_A/California/06/2 1
gi|229892698_A/Canada-NS/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|237511929_A/Mexico/4486/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229576678_A/Canada-NS/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229783393_A/New_York/1669/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892688_A/Canada-NS/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227977136_A/Texas/04/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229396471_A/California/07/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227977148_A/California/07/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227831813_A/California/07/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227831766_A/California/05/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227977116_A/California/04/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227809824_A/California/04/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229396421_A/California/08/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229396391_A/New_York/18/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229484023_A/Canada-ON/RV152      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535803_A/Texas/09/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535975_A/Texas/08/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229536070_A/Texas/07/2009        MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535790_A/New_York/22/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229536028_A/Minnesota/02/20      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229535822_A/California/14/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229536042_A/Arizona/02/2009      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892694_A/Canada-ON/RV152      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892690_A/Canada-ON/RV152      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|237511931_A/Mexico/4604/200      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892696_A/Canada-AB/RV153      MERIKELRDLMSQSRTREILTKTTVDHMAVIKKYTSGRQEKNPALRMKWM 50
gi|229783414_A/New_York/1682/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229892692_A/Mexico/InDRE411      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|229484025_A/Mexico/InDRE448      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|227831783_A/California/06/2      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
gi|237624321_A/swine/Alberta/O      MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50
                                    *****************************:********************

gi|229892698_A/Canada-NS/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|237511929_A/Mexico/4486/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229576678_A/Canada-NS/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229783393_A/New_York/1669/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892688_A/Canada-NS/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227977136_A/Texas/04/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229396471_A/California/07/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227977148_A/California/07/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227831813_A/California/07/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227831766_A/California/05/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227977116_A/California/04/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|227809824_A/California/04/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229396421_A/California/08/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229396391_A/New_York/18/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229484023_A/Canada-ON/RV152      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535803_A/Texas/09/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535975_A/Texas/08/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229536070_A/Texas/07/2009        MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535790_A/New_York/22/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229536028_A/Minnesota/02/20      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229535822_A/California/14/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229536042_A/Arizona/02/2009      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892694_A/Canada-ON/RV152      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892690_A/Canada-ON/RV152      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|237511931_A/Mexico/4604/200      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892696_A/Canada-AB/RV153      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229783414_A/New_York/1682/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229892692_A/Mexico/InDRE411      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|229484025_A/Mexico/InDRE448      MAMRYPITADKRIMDMIPERNEQGQTLWSKTSDAGSDRVMVSPLAVTWWN 100
gi|227831783_A/California/06/2      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
gi|237624321_A/swine/Alberta/O      MAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN 100
                                    *******************************.******************

gi|229892698_A/Canada-NS/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|237511929_A/Mexico/4486/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229576678_A/Canada-NS/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229783393_A/New_York/1669/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892688_A/Canada-NS/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227977136_A/Texas/04/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229396471_A/California/07/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227977148_A/California/07/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227831813_A/California/07/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227831766_A/California/05/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227977116_A/California/04/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227809824_A/California/04/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229396421_A/California/08/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229396391_A/New_York/18/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229484023_A/Canada-ON/RV152      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535803_A/Texas/09/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535975_A/Texas/08/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229536070_A/Texas/07/2009        RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535790_A/New_York/22/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229536028_A/Minnesota/02/20      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229535822_A/California/14/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229536042_A/Arizona/02/2009      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892694_A/Canada-ON/RV152      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892690_A/Canada-ON/RV152      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|237511931_A/Mexico/4604/200      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892696_A/Canada-AB/RV153      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229783414_A/New_York/1682/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229892692_A/Mexico/InDRE411      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|229484025_A/Mexico/InDRE448      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|227831783_A/California/06/2      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
gi|237624321_A/swine/Alberta/O      RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPG 150
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|237511929_A/Mexico/4486/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229576678_A/Canada-NS/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229783393_A/New_York/1669/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892688_A/Canada-NS/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227977136_A/Texas/04/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229396471_A/California/07/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227977148_A/California/07/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227831813_A/California/07/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227831766_A/California/05/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227977116_A/California/04/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227809824_A/California/04/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229396421_A/California/08/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229396391_A/New_York/18/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229484023_A/Canada-ON/RV152      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535803_A/Texas/09/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535975_A/Texas/08/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229536070_A/Texas/07/2009        HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535790_A/New_York/22/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229536028_A/Minnesota/02/20      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229535822_A/California/14/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229536042_A/Arizona/02/2009      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892694_A/Canada-ON/RV152      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892690_A/Canada-ON/RV152      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|237511931_A/Mexico/4604/200      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892696_A/Canada-AB/RV153      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229783414_A/New_York/1682/2      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229892692_A/Mexico/InDRE411      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|229484025_A/Mexico/InDRE448      HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|227831783_A/California/06/2      HADLSAKEAQNVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
gi|237624321_A/swine/Alberta/O      QADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 200
                                    :*********:***************************************

gi|229892698_A/Canada-NS/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|237511929_A/Mexico/4486/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229576678_A/Canada-NS/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229783393_A/New_York/1669/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892688_A/Canada-NS/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227977136_A/Texas/04/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229396471_A/California/07/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227977148_A/California/07/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227831813_A/California/07/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227831766_A/California/05/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227977116_A/California/04/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227809824_A/California/04/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229396421_A/California/08/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229396391_A/New_York/18/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229484023_A/Canada-ON/RV152      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535803_A/Texas/09/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535975_A/Texas/08/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229536070_A/Texas/07/2009        LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535790_A/New_York/22/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229536028_A/Minnesota/02/20      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229535822_A/California/14/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229536042_A/Arizona/02/2009      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892694_A/Canada-ON/RV152      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892690_A/Canada-ON/RV152      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|237511931_A/Mexico/4604/200      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892696_A/Canada-AB/RV153      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229783414_A/New_York/1682/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229892692_A/Mexico/InDRE411      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|229484025_A/Mexico/InDRE448      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|227831783_A/California/06/2      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
gi|237624321_A/swine/Alberta/O      LMVAYMLERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEV 250
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|237511929_A/Mexico/4486/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229576678_A/Canada-NS/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229783393_A/New_York/1669/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892688_A/Canada-NS/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227977136_A/Texas/04/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229396471_A/California/07/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227977148_A/California/07/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227831813_A/California/07/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227831766_A/California/05/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227977116_A/California/04/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227809824_A/California/04/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229396421_A/California/08/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229396391_A/New_York/18/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229484023_A/Canada-ON/RV152      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535803_A/Texas/09/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535975_A/Texas/08/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229536070_A/Texas/07/2009        RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535790_A/New_York/22/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229536028_A/Minnesota/02/20      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229535822_A/California/14/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229536042_A/Arizona/02/2009      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892694_A/Canada-ON/RV152      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892690_A/Canada-ON/RV152      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|237511931_A/Mexico/4604/200      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892696_A/Canada-AB/RV153      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229783414_A/New_York/1682/2      RNDDVDQSLIIAARNIIRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229892692_A/Mexico/InDRE411      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|229484025_A/Mexico/InDRE448      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|227831783_A/California/06/2      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
gi|237624321_A/swine/Alberta/O      RNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGVRMVDILRQ 300
                                    ****************:*********************************

gi|229892698_A/Canada-NS/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|237511929_A/Mexico/4486/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229576678_A/Canada-NS/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229783393_A/New_York/1669/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892688_A/Canada-NS/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227977136_A/Texas/04/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229396471_A/California/07/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227977148_A/California/07/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227831813_A/California/07/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227831766_A/California/05/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227977116_A/California/04/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227809824_A/California/04/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229396421_A/California/08/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229396391_A/New_York/18/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229484023_A/Canada-ON/RV152      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535803_A/Texas/09/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535975_A/Texas/08/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229536070_A/Texas/07/2009        NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535790_A/New_York/22/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229536028_A/Minnesota/02/20      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229535822_A/California/14/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229536042_A/Arizona/02/2009      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892694_A/Canada-ON/RV152      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892690_A/Canada-ON/RV152      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|237511931_A/Mexico/4604/200      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892696_A/Canada-AB/RV153      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229783414_A/New_York/1682/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229892692_A/Mexico/InDRE411      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|229484025_A/Mexico/InDRE448      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|227831783_A/California/06/2      NPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
gi|237624321_A/swine/Alberta/O      NPTEEQAVDICKAAIGLRISSSFRFGGFTFKRTSGSSVKKEEEVLTGNLQ 350
                                    *********************** **************************

gi|229892698_A/Canada-NS/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|237511929_A/Mexico/4486/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229576678_A/Canada-NS/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229783393_A/New_York/1669/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892688_A/Canada-NS/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227977136_A/Texas/04/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229396471_A/California/07/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227977148_A/California/07/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227831813_A/California/07/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227831766_A/California/05/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227977116_A/California/04/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227809824_A/California/04/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229396421_A/California/08/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229396391_A/New_York/18/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229484023_A/Canada-ON/RV152      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535803_A/Texas/09/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535975_A/Texas/08/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229536070_A/Texas/07/2009        TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535790_A/New_York/22/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229536028_A/Minnesota/02/20      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229535822_A/California/14/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229536042_A/Arizona/02/2009      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892694_A/Canada-ON/RV152      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892690_A/Canada-ON/RV152      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|237511931_A/Mexico/4604/200      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892696_A/Canada-AB/RV153      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229783414_A/New_York/1682/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229892692_A/Mexico/InDRE411      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|229484025_A/Mexico/InDRE448      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|227831783_A/California/06/2      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
gi|237624321_A/swine/Alberta/O      TLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIV 400
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|237511929_A/Mexico/4486/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229576678_A/Canada-NS/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229783393_A/New_York/1669/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892688_A/Canada-NS/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227977136_A/Texas/04/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229396471_A/California/07/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227977148_A/California/07/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227831813_A/California/07/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227831766_A/California/05/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227977116_A/California/04/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227809824_A/California/04/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229396421_A/California/08/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229396391_A/New_York/18/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229484023_A/Canada-ON/RV152      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535803_A/Texas/09/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535975_A/Texas/08/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229536070_A/Texas/07/2009        AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535790_A/New_York/22/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229536028_A/Minnesota/02/20      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229535822_A/California/14/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229536042_A/Arizona/02/2009      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892694_A/Canada-ON/RV152      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892690_A/Canada-ON/RV152      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|237511931_A/Mexico/4604/200      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892696_A/Canada-AB/RV153      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229783414_A/New_York/1682/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229892692_A/Mexico/InDRE411      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|229484025_A/Mexico/InDRE448      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|227831783_A/California/06/2      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG 450
gi|237624321_A/swine/Alberta/O      AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMYQLLRHFQKDAKVLFQNWG 450
                                    *******************************:******************

gi|229892698_A/Canada-NS/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|237511929_A/Mexico/4486/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229576678_A/Canada-NS/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229783393_A/New_York/1669/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892688_A/Canada-NS/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227977136_A/Texas/04/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229396471_A/California/07/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227977148_A/California/07/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227831813_A/California/07/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227831766_A/California/05/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227977116_A/California/04/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227809824_A/California/04/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229396421_A/California/08/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229396391_A/New_York/18/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229484023_A/Canada-ON/RV152      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535803_A/Texas/09/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535975_A/Texas/08/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229536070_A/Texas/07/2009        IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535790_A/New_York/22/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229536028_A/Minnesota/02/20      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229535822_A/California/14/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229536042_A/Arizona/02/2009      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892694_A/Canada-ON/RV152      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892690_A/Canada-ON/RV152      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|237511931_A/Mexico/4604/200      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892696_A/Canada-AB/RV153      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229783414_A/New_York/1682/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229892692_A/Mexico/InDRE411      IESIDNVMGMIGIMPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|229484025_A/Mexico/InDRE448      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|227831783_A/California/06/2      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
gi|237624321_A/swine/Alberta/O      IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
                                    *************:************************************

gi|229892698_A/Canada-NS/RV153      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|237511929_A/Mexico/4486/200      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|229576678_A/Canada-NS/RV153      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|229783393_A/New_York/1669/2      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|229892688_A/Canada-NS/RV153      FLRVRDQRGNVLLSPEEVSETQGTERLTITYSSSMMWEINGPESVLVNTY 550
gi|227977136_A/Texas/04/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229396471_A/California/07/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227977148_A/California/07/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227831813_A/California/07/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227831766_A/California/05/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227977116_A/California/04/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227809824_A/California/04/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229396421_A/California/08/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229396391_A/New_York/18/200      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229484023_A/Canada-ON/RV152      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535803_A/Texas/09/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535975_A/Texas/08/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229536070_A/Texas/07/2009        FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535790_A/New_York/22/200      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229536028_A/Minnesota/02/20      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229535822_A/California/14/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229536042_A/Arizona/02/2009      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892694_A/Canada-ON/RV152      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892690_A/Canada-ON/RV152      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|237511931_A/Mexico/4604/200      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892696_A/Canada-AB/RV153      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229783414_A/New_York/1682/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229892692_A/Mexico/InDRE411      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|229484025_A/Mexico/InDRE448      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|227831783_A/California/06/2      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
gi|237624321_A/swine/Alberta/O      FLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY 550
                                    *************************:************************

gi|229892698_A/Canada-NS/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|237511929_A/Mexico/4486/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229576678_A/Canada-NS/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229783393_A/New_York/1669/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892688_A/Canada-NS/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227977136_A/Texas/04/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229396471_A/California/07/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227977148_A/California/07/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227831813_A/California/07/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227831766_A/California/05/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227977116_A/California/04/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227809824_A/California/04/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229396421_A/California/08/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229396391_A/New_York/18/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229484023_A/Canada-ON/RV152      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535803_A/Texas/09/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535975_A/Texas/08/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229536070_A/Texas/07/2009        QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535790_A/New_York/22/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229536028_A/Minnesota/02/20      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229535822_A/California/14/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229536042_A/Arizona/02/2009      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892694_A/Canada-ON/RV152      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892690_A/Canada-ON/RV152      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|237511931_A/Mexico/4604/200      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892696_A/Canada-AB/RV153      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229783414_A/New_York/1682/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229892692_A/Mexico/InDRE411      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|229484025_A/Mexico/InDRE448      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|227831783_A/California/06/2      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
gi|237624321_A/swine/Alberta/O      QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLF 600
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|237511929_A/Mexico/4486/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229576678_A/Canada-NS/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229783393_A/New_York/1669/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892688_A/Canada-NS/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227977136_A/Texas/04/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229396471_A/California/07/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227977148_A/California/07/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227831813_A/California/07/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227831766_A/California/05/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227977116_A/California/04/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227809824_A/California/04/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229396421_A/California/08/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229396391_A/New_York/18/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229484023_A/Canada-ON/RV152      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535803_A/Texas/09/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535975_A/Texas/08/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229536070_A/Texas/07/2009        QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535790_A/New_York/22/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229536028_A/Minnesota/02/20      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229535822_A/California/14/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229536042_A/Arizona/02/2009      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892694_A/Canada-ON/RV152      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892690_A/Canada-ON/RV152      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|237511931_A/Mexico/4604/200      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892696_A/Canada-AB/RV153      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229783414_A/New_York/1682/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229892692_A/Mexico/InDRE411      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|229484025_A/Mexico/InDRE448      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|227831783_A/California/06/2      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
gi|237624321_A/swine/Alberta/O      QQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVR 650
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|237511929_A/Mexico/4486/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229576678_A/Canada-NS/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229783393_A/New_York/1669/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892688_A/Canada-NS/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227977136_A/Texas/04/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229396471_A/California/07/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227977148_A/California/07/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227831813_A/California/07/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227831766_A/California/05/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227977116_A/California/04/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227809824_A/California/04/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229396421_A/California/08/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229396391_A/New_York/18/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229484023_A/Canada-ON/RV152      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535803_A/Texas/09/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535975_A/Texas/08/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229536070_A/Texas/07/2009        GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535790_A/New_York/22/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229536028_A/Minnesota/02/20      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229535822_A/California/14/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229536042_A/Arizona/02/2009      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892694_A/Canada-ON/RV152      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892690_A/Canada-ON/RV152      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|237511931_A/Mexico/4604/200      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892696_A/Canada-AB/RV153      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229783414_A/New_York/1682/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229892692_A/Mexico/InDRE411      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|229484025_A/Mexico/InDRE448      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
gi|227831783_A/California/06/2      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILDKE 700
gi|237624321_A/swine/Alberta/O      GNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKE 700
                                    ***********************************************.**

gi|229892698_A/Canada-NS/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|237511929_A/Mexico/4486/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229576678_A/Canada-NS/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229783393_A/New_York/1669/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892688_A/Canada-NS/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227977136_A/Texas/04/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229396471_A/California/07/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227977148_A/California/07/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227831813_A/California/07/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227831766_A/California/05/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227977116_A/California/04/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227809824_A/California/04/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229396421_A/California/08/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229396391_A/New_York/18/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229484023_A/Canada-ON/RV152      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535803_A/Texas/09/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535975_A/Texas/08/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229536070_A/Texas/07/2009        DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535790_A/New_York/22/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229536028_A/Minnesota/02/20      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229535822_A/California/14/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229536042_A/Arizona/02/2009      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892694_A/Canada-ON/RV152      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892690_A/Canada-ON/RV152      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|237511931_A/Mexico/4604/200      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892696_A/Canada-AB/RV153      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229783414_A/New_York/1682/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229892692_A/Mexico/InDRE411      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|229484025_A/Mexico/InDRE448      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|227831783_A/California/06/2      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
gi|237624321_A/swine/Alberta/O      DKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTA 750
                                    **************************************************

gi|229892698_A/Canada-NS/RV153      TKRIRMAIN 759
gi|237511929_A/Mexico/4486/200      TKRIR---- 755
gi|229576678_A/Canada-NS/RV153      TKRIRMAIN 759
gi|229783393_A/New_York/1669/2      TKRIRMAIN 759
gi|229892688_A/Canada-NS/RV153      TKRIRMAIN 759
gi|227977136_A/Texas/04/2009        TKRIRMAIN 759
gi|229396471_A/California/07/2      TKRIRMAIN 759
gi|227977148_A/California/07/2      TKRIRMAIN 759
gi|227831813_A/California/07/2      TKRIRMAIN 759
gi|227831766_A/California/05/2      TKRIRMAIN 759
gi|227977116_A/California/04/2      TKRIRMAIN 759
gi|227809824_A/California/04/2      TKRIRMAIN 759
gi|229396421_A/California/08/2      TKRIRMAIN 759
gi|229396391_A/New_York/18/200      TKRIRMAIN 759
gi|229484023_A/Canada-ON/RV152      TKRIRMAIN 759
gi|229535803_A/Texas/09/2009        TKRIRMAIN 759
gi|229535975_A/Texas/08/2009        TKRIRMAIN 759
gi|229536070_A/Texas/07/2009        TKRIRMAIN 759
gi|229535790_A/New_York/22/200      TKRIRMAIN 759
gi|229536028_A/Minnesota/02/20      TKRIRMAIN 759
gi|229535822_A/California/14/2      TKRIRMAIN 759
gi|229536042_A/Arizona/02/2009      TKRIRMAIN 759
gi|229892694_A/Canada-ON/RV152      TKRIRMAIN 759
gi|229892690_A/Canada-ON/RV152      TKRIRMAIN 759
gi|237511931_A/Mexico/4604/200      TKRIRMAIN 759
gi|229892696_A/Canada-AB/RV153      TKRIRMAIN 759
gi|229783414_A/New_York/1682/2      TKRIRMAIN 759
gi|229892692_A/Mexico/InDRE411      TKRIRMAIN 759
gi|229484025_A/Mexico/InDRE448      TKRIRMAIN 759
gi|227831783_A/California/06/2      TKRIRMAIN 759
gi|237624321_A/swine/Alberta/O      TKRIRMAIN 759
                                    *****    

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools