Sandbox 323: Difference between revisions
From Proteopedia
Jump to navigationJump to search
No edit summary |
Emma Caszatt (talk | contribs) No edit summary |
||
| (32 intermediate revisions by 3 users not shown) | |||
| Line 1: | Line 1: | ||
==Proposed Structure of 3DS8 Protein== | ==Proposed Structure of 3DS8 Protein== | ||
<StructureSection load='3DS8' size='300' side='right' caption='3DS8 Structure' scene=''> | <StructureSection load='3DS8' size='300' side='right' caption='3DS8 Structure' scene=''> | ||
<scene name='10/1043632/3ds8_secondary_structure/1'>3DS8 Secondary Structure</scene> | |||
The discovery and characterization of the structure and function of the protein 3DS8. | The discovery and characterization of the structure and function of the protein 3DS8. | ||
This project aimed to characterize the function of an unknown protein 3DS8 with a known structure by comparing it to known proteins and subjecting it to different tests in the laboratory. | This project aimed to characterize the function of an unknown protein 3DS8 with a known structure by comparing it to known proteins and subjecting it to different tests in the laboratory. | ||
Different techniques to achieve this goal include protein expression, purification and analysis, kinetics, and computational methods. | Different techniques to achieve this goal include protein expression, purification and analysis, kinetics, and computational methods. | ||
== Function == | == Function == | ||
| Line 14: | Line 14: | ||
The function was not confirmed during wet lab experiments due to protein and reagent complications. | The function was not confirmed during wet lab experiments due to protein and reagent complications. | ||
== Experimental == | There have been previous studies conducted on the 3DS8 protein concluding that it is an alpha-beta hydrolase and originates from the Lin2722 gene in ''Listeria innocua'', a species of Gram-positive bacteria. Studies included database searches and the measurement of enzymatic activity by UV-Vis colorimetric assays using p-nitrophenyl analogs to form p-nitrophenol.[1] | ||
The beginning experiments were conducted on molecular docking sites to compare the structure of the 3DS8 active site with known proteins. Using the SPRITE database [ | |||
the 3DS8 protein was matched with a few proteases through right-handed superpositions with RMSD values ranging from 1.20-1.40, indicating relative similarities. | The αβ-hydrolases found in plants have many functions, including ligand receptors and catalytic activity. They are also adaptable and malleable regarding the fold of the protein secondary structure, which makes them an ideal target for research. [2] | ||
</StructureSection> | |||
== Materials == | |||
- Buffers: Sodium Phosphate buffer, Cell Lysis Buffer Tris-HCl, 10X SDS-PAGE Buffer, Re-Suspension Buffer, 1X Wash Buffer, 1X Elution Buffer | |||
- Solutions for SDS-Page: Coomassie Blue Stain, and Destain | |||
- Pre-cast SDS-Page Gel | |||
== Experimental and Results == | |||
The beginning experiments were conducted on molecular docking sites to compare the structure of the 3DS8 active site with known proteins. Using the SPRITE database [3], the 3DS8 protein was matched with a few proteases through right-handed superpositions with RMSD values ranging from 1.20-1.40, indicating relative similarities. | |||
The left-handed superpositions matched with more trypsins and displayed better RMSD values ranging from 0.93-1.11. | The left-handed superpositions matched with more trypsins and displayed better RMSD values ranging from 0.93-1.11. | ||
The 3DS8 protein did not have many very specific active site matches with known proteins on the Chimera software [4], however, it was very similar to trypsin, | |||
The 3DS8 protein did not have many very specific active site matches with known proteins on the Chimera software [ | |||
alpha-chymotrypsin, and proteinase B. The function of 3DS8 is most likely very similar to those since the active sites have the same amino acids and structures that differ within <4 angstroms. | alpha-chymotrypsin, and proteinase B. The function of 3DS8 is most likely very similar to those since the active sites have the same amino acids and structures that differ within <4 angstroms. | ||
The Dali database [ | The Dali database [5] was used to determine the conserved sequences within the 3DS8 protein. The majority of the hits were lipases with Z-scores up to 31.8, meaning the proteins are homologous | ||
to the 3ds8 structure because they are higher than 20. Some hits had high LALI numbers that indicate matching residues in the structure. The active site residues are G104, S102, H222, D188. Each of | to the 3ds8 structure because they are higher than 20. Some hits had high LALI numbers that indicate matching residues in the structure. The active site residues are G104, S102, H222, D188. Each of | ||
these is conserved in the 4 selected protein matches, which means that the active site is conserved. The 3ds8 active site is conserved in many other proteins with similar functions, many of which | these is conserved in the 4 selected protein matches, which means that the active site is conserved. The 3ds8 active site is conserved in many other proteins with similar functions, many of which | ||
| Line 30: | Line 42: | ||
The BLAST database [ | The BLAST database [6] was utilized to search for similar gene sequences and corresponding residue patterns. Using the FASTA sequence, the 3DS8 sequence is matched with similar proteins in an | ||
alignment that shows similar positions of matching residues. The superfamily of | alignment that shows similar positions of matching residues. The superfamily of 3DS8 is an αβ-hydrolase. Function and cellular position are unknown, but it is hydrolase-like and exists in bacteria. | ||
The 3DS8 protein is part of the superfamily of alpha-beta hydrolases, so it most likely has the same function. Many structural and sequential similarities are conserved between 3DS8 | The 3DS8 protein is part of the superfamily of alpha-beta hydrolases, so it most likely has the same function. Many structural and sequential similarities are conserved between 3DS8 | ||
and matched proteins, indicating that 3DS8 could very well be a hydrolase. | and matched proteins, indicating that 3DS8 could very well be a hydrolase. | ||
| Line 37: | Line 49: | ||
FASTA sequence of 3DS8: | FASTA sequence of 3DS8: | ||
KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFND | |||
LDPNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK | |||
InterPro Scan [ | InterPro Scan [7] searched for structure and taxonomy relations. The results have information about the domains and families of the protein. At the bottom, there are biological processes, | ||
molecular functions, and cellular components to learn more about the protein and where it originates from. InterPro confirmed that 3DS8 is most likely a hydrolase. Since 3DS8 is part of | molecular functions, and cellular components to learn more about the protein and where it originates from. InterPro confirmed that 3DS8 is most likely a hydrolase. Since 3DS8 is part of | ||
the hydrolase superfamily, its structure and function are likely to be that of some sort of hydrolase. | the hydrolase superfamily, its structure and function are likely to be that of some sort of hydrolase. | ||
| Line 51: | Line 63: | ||
The molecular weight of 3DS8 is proposed to be about 28 kDa. | The molecular weight of 3DS8 is proposed to be about 28 kDa, based on the length of the amino acid sequence. | ||
In the laboratory, the gene was transformed into ''E. coli'' bacteria, expressed and isolated by cell lysis and nickel column. The cell lysis buffer used was a sodium phosphate buffer. From the column, 10 elution fractions were collected. A Bradford assay with standards of 0.125, 0.25, 0.5, 0.75, and 1 mg/mL of Bovine Serum Albumin solution. The standards were measured on a UV-Vis spectrophotometer at 595 nm. Initially, a few of the elution fractions were out of the standard range of absorbance, so the samples were remade by diluting further. After the second round of absorbances was obtained, only elution 4 was still out of range. Then Beer's law (A=εbc) was used to determine the concentrations (mg/mL) of each elution fraction: E1=0.4026, E2=5.968, E3=5.434, E4=-0.1407, E5=0.5610, E6=0.4229, E7=0.03175, E8=0.1461, E9=0.2693, E10=0.2244. | |||
Fractions E1 through E6 were chosen to be run on an SDS-PAGE gel because they contained the highest amounts of protein. After running for an hour on 100-150 mV, the gel was stained and destained. The bands appeared around 30 kDa and fractions E2-E6 were pure. The controls include running samples from before and after the column and wash. | |||
The ligand used for testing was p-nitrophenyl acetate (PNPA) in pH's of 4, 5, 6, 7, and 8. In each cuvette, 5 µL of protein, 50 µL of ligand, and 1.5 mL buffer (varying pH) were added. Absorbance was measured at 405 nm for 30 min, taking a reading every minute until 20 minutes, then every 20 seconds. After doing 2 repetitions of pH 8, one of 7, and one of 5, it was determined that the protein had crashed out of the solution and was not reacting with the PNPA. | |||
==Discussion== | ==Discussion== | ||
The 3DS8 protein had already been sequenced, so comparisons between sequence and structure were carried out in a variety of programs to discern the possible function. After finding homologous and conserved regions from the databases, it was determined that the protein was an αβ-hydrolase. Once the function was proposed, common ligands were found to be modeled in active site docking software. During the molecular docking studies, PNPA was discovered to be a good ligand with multiple bonds to the active site of 3DS8. The protein vector was purchased and the 3DS8 protein was purified from the bacteria. The amount of protein in each column was quantified using a Bradford Assay to determine the elutions with the highest concentration of protein. Some elutions had a negative amount, due to either being out of range of the plot or instrumental variation. Some of the samples were remade in order to correctly quantify them using the Bradford Assay. To verify the correct protein was purified from the column, gel electrophoresis was run. The gel confirmed a protein around 30 kDa, which was proposed earlier. To assess the activity of the protein, the protein was going to be assessed with the various ligands found in the molecular docking studies using UV-Vis. Many of the other possible substrates, such as PNP Butyrate, were on backorder but PNPA was delivered. The activity of the protein was all baseline, even after having complete saturation of the ligand in protein solution at various pH. After much confusion, it was concluded that the protein was no longer viable. Unfortunately, since the project was done over a couple of weeks, the concentration of protein in the elutions was too high and crashed out. The raw data about the 3DS8 activity was inconclusive. | |||
== Conclusions == | == Conclusions == | ||
The structure of 3DS8 was honed in on after matching the sequence with various other proteins in databases such as BLAST, SPRITE, and DALI. The sequence matches gave information about the active site and possible functions of the protein. The structure was then determined by the sequence in programs such as Chimera, InterPro, and SwissDock. The combination of this research suggested that the 3DS8 protein is a hydrolase. Gel electrophoresis confirmed that the protein was obtained as a dark band was visualized around 30 kDa. Various ligands that are common for hydrolysis were examined and modeled, and the best were planned to be used in the lab to gather data. Unfortunately, many of the ligands were on backorder and only PNPA was able to be used in enzymatic activity assays. No data about the activity was obtained, as all the purified protein crashed out of solution before the assay could be run. | |||
== References == | == References == | ||
<references/> | <references/> | ||
1. http://211.25.251.163/sprite/ | 1. Sharkawy, M.; Carter, A.A.; Craig, P. Function Identification of the Protein Product of Gene Lin2722 from | ||
Listeria innocua using Computational and In-Vitro Techniques. https://www.cell.com/biophysj/pdf/S0006-3495(18)31671-0.pdf | |||
2. Mindrebo, J. T.; Nartey, C. M.; Seto, Y.; Burkart, M. D.; Noel, J. P. Unveiling the functional diversity of the alpha/beta hydrolase superfamily in the plant kingdom. Science Direct. 2016, 41, 233-246. DOI: 10.1016/j.sbi.2016.08.005. | |||
3. http://211.25.251.163/sprite/ | |||
4. https://www.cgl.ucsf.edu/chimera/download.html | |||
5. http://ekhidna2.biocenter.helsinki.fi/dali/ | |||
6. https://blast.ncbi.nlm.nih.gov/Blast.cgi | |||
7. https://www.ebi.ac.uk/interpro/ | |||