Sandbox 30: Difference between revisions

From Proteopedia
Jump to navigationJump to search
Student (talk | contribs)
No edit summary
Student (talk | contribs)
No edit summary
 
(36 intermediate revisions by the same user not shown)
Line 2: Line 2:
{{Template:Oberholser_Sandbox_Reservation}}
{{Template:Oberholser_Sandbox_Reservation}}
<!-- PLEASE ADD YOUR CONTENT BELOW HERE -->
<!-- PLEASE ADD YOUR CONTENT BELOW HERE -->
 
= '''Papain''' =
= '''Trypsin''' =
Note: For some reason, using the "hydrogen bonds" link in the structure section breaks the jmol display and results in scenes after that point having random disulfide bonds and solvent molecules floating in mid-air.  I've tried to fix it but to no avail, so if this happens just refresh the page and everything should work again.  Oh look, now the new h-bond link in the substrate binding section does the same thing.  If you see disembodied floating solvent molecules after clicking it, just refresh the page.
[[Image:1qlq.jpg|left|200px]]  
(Specifically PDB: 1QLQ)


==Overview==
==Overview==
Trypsin was first isolated by Wilhelm Kühne in 1867<ref>[https://www.doria.fi/bitstream/handle/10024/2142/trypsinr.pdf?sequence=1 ISBN 952-10-1863-1]</ref>. Trypsin is a serine protease synthesized in the pancreas but is not activated until the zymogen form of trypsin is activated.  This prevents trypsin from digesting actual body tissue<ref> [http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TGT-49S6WV8-1&_user=4187488&_coverDate=12/31/2003&_rdoc=1&_fmt=high&_orig=search&_origin=search&_sort=d&_docanchor=&view=c&_acct=C000062504&_version=1&_urlVersion=0&_userid=4187488&md5=a7d7e1b154a43b709d5228c4852e5d10&searchtype=a doi:10.1016/j.theochem.2003.08.072]</ref>. Serine proteases were instrumental in the discovery and subsequent study of enzymes due to there high stability and large quantities in digestive juices.  One of the first proteins to be studied via X-ray crystallography was Chymotrypsin. Trypsin cleaves on the C-terminus side of lysine and arginine<ref>[http://www.pdb.org/pdb/static.do?p=education_discussion/molecule_of_the_month/pdb46_1.html  Protein Data Bank]</ref>.
[[Image:Papain_cartoon.png|200px|left|thumb|]]
An easy way to distinguish between main structural components of the protein is to view it using <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>rainbow coloration.</scene> 
<applet load='9PAP' size='400' frame='true' align='right' scene='Sandbox_30/Papain_default/7' caption='Click on the links to the left to view different structural aspects. PDB code for this 1.65 Å resolution structure is 9PAP.'  />
Papain is a 23.4 kDa, 212 residue cysteine endopeptidase originating from the fruit of ''Carica papaya'', where it is present in significant amounts along with three other cysteine proteases, chymopapain, glycyl endopeptidase, and caricain<ref name="9PAP PDB">[http://www.pdb.org/pdb/explore/explore.do?structureId=9PAP] 9PAP PDB</ref><ref name="sigma">[http://www.sigmaaldrich.com/life-science/metabolomics/enzyme-explorer/analytical-enzymes/papain.html] Sigma Aldrich</ref><ref name="worthington">[http://www.worthington-biochem.com/pap/default.html] Worthington Biochemical Corporation</ref>. Its action was first described by G.C. Roy in 1873.  It was studied intensively from the 1950s to the 1960s, during which time it became the second enzyme ever to have its structure determined by x-ray crystallography.  Finally, high resolution structural analysis in the 1980s allowed an accurate description of the enzyme's active site<ref name="worthington" />.  Papain displays very wide hydrolase activity, serving as a general amidase and esterase in addition to its protease activity.  As a protease, papain can hydrolyze bonds of basic amino acids, leucine, and glycine.  It shows preference for residues preceded by a large hydrophobic residue, but will not cleave if valine is present on the carboxyl side of a potential cleavage site.  In addition to being a very non-specific enzyme, papain is also unusually heat resistant, with maximal activity occurring at a temperature of 65° C.  These properties have led to use of papain in a large variety areas.  One of these areas is biological research, where papain is utilized in cell isolation. It is also useful in immunological techniques because of its ability to cleave the connection between the crystallizable fragment domain and the immunoglobulin domain of antibodies<ref name="sigma" />.  Additionally, papain has found use outside of research as an inflammation control agent, a digestive aid, and even a meat tenderizer<ref>[http://www.webmd.com/vitamins-supplements/ingredientmono-69-PAPAIN.aspx?activeIngredientId=69&activeIngredientName=PAPAIN] WebMD</ref>.






==Structure==
==Structure==
<applet load='1QLQ' size='450' frame='true' align='right' caption='Click on the links to the left to view different structural aspects. Ligand shown: SO4'  />
The secondary structure of papain consists of 7 <scene name='Sandbox_30/Papain_secondary_helices/3'>α helices</scene>, 17 <scene name='Sandbox_30/Papain_secondary_sheets/3'>β strands</scene>, all of which are antiparallel, and a large amount (about 50% of total residues) of <scene name='Sandbox_30/Papain_secondary_orf/4'>ordered non-repetitive structures</scene>.  The <scene name='Sandbox_30/Papain_rainbow/3'>rainbow coloration view</scene>, which goes from blue (amino terminus) to red (carboxyl terminus) is useful for tracing the order of these structures through the chain.  These secondary structures form as a result of favorable hydrogen bonding interactions within the polypeptide backbone.  Meanwhile, secondary structures are kept in place by hydrophobic interactions and hydrogen bonds between sidechains of adjacent structures.  For example, the <scene name='Sandbox_30/Papain_secondary_helices_1/1'>first helix</scene> (residues 25-42) is maintained as a result of <scene name='Sandbox_30/Papain_secondary_helices_hbond/3'>hydrogen bonds</scene> between backbone carbonyl atoms and the hydrogen on the amide nitrogen four residues away.  However, <scene name='Sandbox_30/Papain_secondary_heliceshbond2/1'>no hydrogen bonds</scene> are present between this helix and the rest of the protein, suggesting that this helix is coordinated primarily by hydrophobic interactions.  This is reasonable given its central location in the enzyme.  As expected, the helix contains many <scene name='Sandbox_30/Papain_secondary_helix1_phobic/1'>hydrophobic residues</scene> (red residues are hydrophilic).  The tertiary structure of papain is also maintained by three <scene name='Sandbox_30/Papain_disulfides/3'>disulfide bonds</scene>, which connect <scene name='Sandbox_30/Papain_disulfides_22-63/1'>Cys-22 to Cys63</scene>,
Trypsin's primary amino acid sequence (RPDFCLEPPYAGACRARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA) <ref>[http://bip.weizmann.ac.il/oca-bin/send-seq?1qlq_A 1qlq]</ref> forms the <scene name='Sandbox_30/Backbone/1'>backbone</scene> of the protein, which then folds into secondary structures, consisting of two <scene name='Sandbox_30/Helixs_maroon/3'>α helices</scene> and two <scene name='Sandbox_30/Sheets_green/4'>β sheets</scene>.  Both of the α helices are right handed and the β sheets are anti-parallel. The order of the secondary structures is easily visible when using the <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>rainbow coloration</scene> scheme to identify secondary structures.  The N-terminus (blue) is the beginning of trypsin and the C-terminus (agua-green) is the end.
<scene name='Sandbox_30/Papain_disulfides_56-95/1'>Cys-56 to Cys-95</scene>, and <scene name='Sandbox_30/Papain_disulfides_153-200/1'>Cys-153 to Cys-200</scene><ref name="9PAP PDB" />.  These disulfide bonds are likely important in conserving the structural integrity of the enzyme as it operates in extracellular environments at high temperatures.
 
===Residue Distribution===
As can be seen from its <scene name='Sandbox_30/Papain_polarity_ballandstick/3'>ball and stick model</scene>, papain contains a variety of acidic (red), basic (blue), hydrophilic uncharged (pink), and hydrophobic (gray) residues.  Since the enzyme operates in free solution, it would be expected that the hydrophilic residues would reside mostly on it exterior, shielding a hydrophobic core.  This can be plainly seen from papain's <scene name='Sandbox_30/Papain_polarity_spacefill/4'>space filling model</scene>, in which hydrophilic residues are pink and hydrophobic residues are orange. Upon removal of the hydrophilic residues, the <scene name='Sandbox_30/Papain_hydrophobic_spacefill/3'>hydrophobic core</scene> of the enzyme is easy to see.  As with all proteins, it is this hydrophobic segregation that allows the protein to properly fold and maintain a meaningful shape.
 
===Ligands===
The crystallization procedure used to obtain the 9PAP structure was carried out using a 62% (w/w) methanol and water crystallization medium.  Thus, the papain in this crystal structure is coordinated by <scene name='Sandbox_30/Papain_methanol/1'>methanol molecules</scene>, 29 of which are shown, and <scene name='Sandbox_30/Papain_water/1'>water molecules</scene>, 21 of which occur between adjacent papain molecules and are probably important in maintaining their structural integrity<ref name="9PAP PDB" />.  Both
<scene name='Sandbox_30/Papain_methanol_h-bondint/1'>methanol</scene> (red and grey) and <scene name='Sandbox_30/Papain_water_h-bonds/3'>water</scene> (purple) molecules form hydrogen bonds with many different residues, which are shown as ball and stick structures in the diagrams. Some of the ethanol molecules also have <scene name='Sandbox_30/Papain_methanol_hydrophobicint/3'>hydrophobic interactions</scene> with the enzyme.


==Polar and Nonpolar Residues==
Polar residues are typically hydrophobic, and seek to be sheltered from the aqueous environments that proteins typically inhibit.  The polarity of an amino acid is determined by its <scene name='Sandbox_30/Side_chains/1'>side chain</scene> (orange).  When considering the <scene name='Sandbox_30/Polar_and_nonpolar/1'>ball and stick model</scene> it may look like the polar (blue) and nonpolar (crimson) residues are not organized in a specific manner, but when you consider the <scene name='Sandbox_30/Polar_and_nonpolar/2'>space filling model,</scene> it is evident that the majority of the nonpolar residues are shielded by the polar residues.
Another way to show this principle is by looking at the location of the <scene name='Sandbox_30/Hydrophobic_red/1'>hydrophobic sections</scene> of Trypsin (red).  Alternatively, for a more in depth analysis of trypsin, you can view 
<scene name='Sandbox_30/Space_fill_charge_and_polar/1'>charged (Blue +)(Red -), uncharged polar (purple), and hydrophobic (gray) space filling rendering</scene> which can be even more informing. The hydrophobic portions desire to be shielded from the water in the smallest area possible in order to minimize its interaction with water, thereby maximizing the entropy of the water. It is evident that basically all water molecules are kept outside the protein when viewing a <scene name='Sandbox_30/Ball_and_stick_with_water/1'>rendering with water</scene> (water-blue, trypsin-orange).  This form of trypsin (PDB 1QLQ), has been modified to help enable its crystalization, and thus has four water molecules inside of it instead of the normal three which is present in the wild-type trpsin<ref> Czapinska, Honorata  et al. "High-resolution structure of bovine pancreatic trypsin inhibitor with altered binding loop sequence." ''Journal of Molecular Biology.'' Volume 295, Issue 5, 4 February 2000, Pages 1237-1249 [http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6WK7-45F4TXM-2W&_user=4187488&_coverDate=02/04/2000&_rdoc=1&_fmt=high&_orig=search&_origin=search&_sort=d&_docanchor=&view=c&_acct=C000062504&_version=1&_urlVersion=0&_userid=4187488&md5=221a9d3b8b66f6f908a8d93c6b10f18f&searchtype=a#secx12 doi:10.1006/jmbi.1999.3445] </ref>.


==Intramolecular and Intermolecular Forces==
==Catalytic Mechanism==
The structure of trypsin is stabilized by a variety of intramolecular and intermolecular forces.  Trypsin has three <scene name='Sandbox_30/Disulfied_bonds/2'>disulfide bonds,</scene> which form between the cysteine amino acids.  The cysteine amino acids are shown as pink, and you can see how they are placed in the proper 3-dimensional space to bond with each other.  The bond they form is represented by the yellow bar in between them, as each of their sulfurs bind to one another.  Disulfide bonds are especially important for structural stability in extracellular environments, where conditions are more prone to fluctuation. Secondary structures are stabilized via interactions that compliment their specific side chains.  For example, the first α helix in trypsin's structure is stabilized by several other
<applet load='1pop' size='300' frame='true' align='right' scene='Sandbox_30/Papain_ligand_default/4' caption='Papain crystallized with substrate analog leupeptin (blue) covalently bound to the catalytic Cys-25.  The PBD code for this structure is 1POP.' />
<scene name='Sandbox_30/A_helix_hydrophobic/1'>hydrophobic residues</scene> in the molecule itself.  The ball and stick amino acids marked with an * are part of α helix while the space filling molecules stabilize the α helix. the The α helix is also stabilized by <scene name='Sandbox_30/A_helix_hydrogen_bonds/1'>intramolecular hydrogen bonding,</scene> as well as
[[Image:Papainmech6.jpg|200px|left|thumb| General mechanism of papain catalysis<ref>[http://chemistry.umeche.maine.edu/CHY431/Peptidase10.html] University of Maine</ref>.  Arg-175, which orients His 159, and Gln-19, which contributes to the formation of the oxyanion hole, are not shown.]]
<scene name='Sandbox_30/A_helix_hydrogen_bonds/2'>the addition of hydrogen bonding to water molecules</scene> (water is dark blue).
Like serine proteases, cysteine proteases contain a <scene name='Sandbox_30/Papain_ligand_active-site/3'>catalytic triad</scene> of residues.  In the case of papain, these residues are Cys-25, His-159, and Arg-175. Papain also contains a fourth residue, <scene name='Sandbox_30/Papain_ligand_active-sitegln19/5'>Gln-19</scene> that has been shown to play an important role in catalysis and is likely involved in the formation of the oxyanion hole. The mechanism begins when a peptide binds to the active site.  Cys-25 is then deprotonated by His-159 and attacks the substrate carbonyl carbon.  This forms a covalent, tetrahedral intermediate that is stabilized by the oxyanion hole.  Next, His-159 acts as a general acid, protonating the nitrogen in the peptide bond, which acts as a leaving group as the carbonyl reforms.  This now free C-terminal portion of the peptide is released.  Water then enters the active site and attacks the carbonyl carbon while it is deprotonated by His-159, again forming an oxyanion hole-stabilized tetradral covalent intermediate.  Finally, the carbonyl reforms and the Cys-25 sulfur acts as a leaving group, releasing the N-terminal portion of the peptide and regenerating the enzyme<ref name="Harrison">[http://pubs.acs.org/doi/abs/10.1021/ja9711472]Harrison, M.J., N.A. Burton, and I.H. Hillier. 1997. Catalytic Mechanism of the Enzyme Papain: Predictions with a Hybrid Quantum Mechanical/Molecular Mechanical Potential. J. Am. Chem. Soc. 119: 12285-12291</ref>.
The <scene name='Sandbox_30/Beta_sheet_interactions/1'>β sheets</scene> (β sheets are ball and stick) have a more bilaterally divided type of bonding.  One side of the β sheets are exposed to water (pink), and are stabilized by hydrogen bonding.  Additionally, there are many hydrophobic interactions (gray) on the internal side of the β sheets.  There are some intramolecular hydrogen bonding which is shown as light blue(oxygen) and blue(nitrogen).
 


[[Image:SO4_Ligand.JPG|right|180px]]
===Ligands===
There are four <scene name='Sandbox_30/So4_ligands/1'>ligands</scene> present in 1QLQ, which are stabilized mostly by hydrogen bonding.  For example, <scene name='Sandbox_30/So4_ligand_62_a/1'>SO4 62 A</scene> is stabilized by hydrogen bonds using the oxygens on SO4. There is a image to the right showing the bonding interaction.


==Cleavage Mechanism==
Serine proteases cleave using what is commonly called a catalytic triad. This catalytic triad consists of Asp 102, His 57, and Ser 195<ref>Polgár L. "The catalytic triad of serine peptidases". Cell. Mol. Life Sci. October 2005. 62 (19-20): 2161–72.  [http://www.springerlink.com/content/l3t068x156682u55/ doi:10.1007/s00018-005-5160-x]</ref>.  The cleavage mechanism is shown to the left. First, the substrate binds to trypsin, and then the side chain oxygen of Ser 195 nucleophilicly attacks, with assist from His 57. Next, the peptide bond is cleaved, with His 57 assisting again with stabilization.  After cleavage, the first product is released.  Next there is a nucleophilic attack of H20 on the acyl-enzye intermediate (assistance of His 57). This is followed by the decomposition of the acyl intermediate and release of the second product<ref>Polgár L. "The catalytic triad of serine peptidases". Cell. Mol. Life Sci. October 2005. 62 (19-20): 2161–72.  [http://www.springerlink.com/content/l3t068x156682u55/ doi:10.1007/s00018-005-5160-x]</ref>. <applet scene='Sandbox_30/Big_trypsin_rainbow/1' size='300' frame='true' align='right' caption='Bovine trypsin in complex with UB-THR 10' /> You are able to view the <scene name='Sandbox_30/Active_site/1'>actual binding site</scene>. Additionally, you may see the <scene name='Sandbox_30/Active_site/3'>substrate in the binding site</scene>.


[[Image:Serine_cleavage.jpg|left|150px]]
===Substrate Binding===
In order to investigate binding of protein substrates to papain, the enzyme was crystallized with the broad-spectrum competitive protease inhibitor leupeptin, shown in blue in the ribbon diagram.  It has the structure Ac-Leu-Leu-Arginal, where Ac is an acetyl group attached to the nitrogen of the first leucine.  The inhibitor functions by binding to the enzyme's active site, where the catalytic nucleophile (cysteine in papain) attacks the arginal aldehyde.  This forms a tight-binding transition state from which the normal catalytic mechanism cannot proceed, due to this carbonyl having no potential leaving groups bonded to it.  Analysis of the resulting structure revealed that the
<scene name='Sandbox_30/Papain_inhibitor_activesite/3'>substrate binding pocket</scene> of papain consists primarily of a variety of <scene name='Sandbox_30/Papain_inhibitor_hydrophobics/1'>hydrophobic residues</scene>, including tyrosine, tryptophan, and valine, which coordinate the bound leuptin.  Some of the enzyme's residues also make <scene name='Sandbox_30/Papain_inhibitor_h-bonds/2'>hydrogen bonds</scene> with some of the leupeptin atoms.  These hydrogen bonds, shown in yellow, include interactions between both hydrogens on both Gln-19 and the amide nitrogen of the catalytic Cys-25 with the arginal carbanion, forming the catalytically important oxyanion hole.  In addition, Gly-66 interacts with the second leucine in leupeptin while Asp-158 interacts with a hydrogen on the arginal.  These interaction further stabilize and orient the substrate in the binding pocket<ref name="Schroder">[http://www.sciencedirect.com/science/article/pii/001457939381128M] Schröder, E., C. Phillips, E. Garman, K. Harlos, C. Crawford. 1997. X-ray crystallographic structure of a papain-leupeptin complex. FEBS Letters 315: 38-42</ref>. 




==Trypsinogen==
Trypsin's zymogen form is called trypsinogen, and can actually activate itself.  Zymogens require a biochemical change to activate.  Only an activated form of trypsin can activate the trypsinogen, and this initial activation is carried out by enteropeptidase, which is a serine protease as well.  Because activated forms of trypsin can activate others, trypsin is said to be autocatalytic<ref>Voet, Donald et al. Fundamentals of Biochemistry - Life at the Molecular Level. 3rd ed. John Wiley & Sons, Inc. 2008</ref>. In addition to activating itself, it can also activate [http://www.proteopedia.org/wiki/index.php/Chymotrypsin chymotrypsin] and [http://www.proteopedia.org/wiki/index.php/Elastase elastase].




==References==
==References==
<references />
<references />