Sandbox 46: Difference between revisions

From Proteopedia
Jump to navigationJump to search
Student (talk | contribs)
No edit summary
Student (talk | contribs)
No edit summary
 
(62 intermediate revisions by 3 users not shown)
Line 1: Line 1:
{{STRUCTURE_1w68 |  PDB=1w68  |  SCENE=  }}
<!-- PLEASE DO NOT DELETE THIS TEMPLATE -->
{{STRUCTURE_1w69 |  PDB=1w69  |  SCENE= }}
{{Template:Oberholser_Sandbox_Reservation}}
==Mouse Ribonucleotide Reductase R2==
<!-- PLEASE ADD YOUR CONTENT BELOW HERE -->
Protein ID:
<Structure load='1AKE A' size='500' frame='true' align='right' caption='Adenylate Kinase' scene='Sandbox_46/1ake_main/2' />
=Adenylate Kinase=
<scene name='Sandbox_46/1ake_main/2'>Adenylate kinase</scene>  is a enzyme that catalyzes the conversion of 2 units of ADP into a unit of ATP and a unit of AMP. It is because of this catalytic role that adenylate kinase is an important part of homeostasis. Consisting of only 211 amino acids, adenylate kinase is not that large of an enzyme, despite its vital role in metabolism.
=Structure=


1w68 (under oxidizing conditions)
The <scene name='Sandbox_46/1ake_secondary/1'>secondary structure</scene> of adenylate kinase shows alpha helices (blue) and beta sheets (teal) surrounding the non-hydrolysable substrate analogue. The enzyme is comprised of 9 helices and 9 sheets constituting the secondary structure. As with any enzyme, the <scene name='Sandbox_46/1ake_hydrogen/1'>hydrogen bonds</scene> (May not load) between the residues of the peptide chains supply the final folded protein with structural stability which helps hold it in its folded configuration.


1w69 (under reducing conditions)<ref>http://blast.ncbi.nlm.nih.gov/Blast.cgi</ref>
This secondary structure is oriented as such so that the <scene name='Sandbox_46/1ake_phobicphilic/2'>hydrophobic and hydrophilic residues</scene> are buried or exposed depending on their individual properties. The hydrophobic, represented in grey, are buried as to avoid as much contact with water as possible. Similarly, the hydrophilic, or polar, residues are colored purple and exposed as much to water as possible. This is further illustrated by the <scene name='Sandbox_46/1ake_water/1'>water solvation</scene> model, displaying water molecules as pink orbs and the enzyme as a translucent white. These hydrophobic interactions, burying of non polar residues and exposure of polar ones, is another main driving force conserving the tertiary structure of the enzyme.


==Introduction==
The model of adenylate kinases shows displays the non-hydrolysable substrate as the ligand. The <scene name='Sandbox_46/1ake_ligandinteract/1'>residues interacting with the ligand</scene> are polar as the substrate is also highly negatively charged. The ligand can be seen in the active site of the enzyme, and shown in standard atomic coloring scheme. The <scene name='Sandbox_46/1ake_catalytic/1'>catalytic residues</scene> are the residues that directly interact with the ligand, and can be seen in yellow.
Mouse ribonucleotide reductase is a class I enzyme. Class I enzymes consist of two different subunits. These two subunits are connected via hydrogen bonds. This enzyme acts primarily to catalyze the reduction of nucleoside diphosphates to deoxynucleoside diphosphates. Within DNA synthesis, this is the first dedicated step. The R2 subunit, a homodimer, is the smaller of the two subunits in this enzyme and serves as a limiting agent for overall enzyme activity. This subunit acts to maintain the tyrosil radical neighboring a diiron carboxylate site. In the mouse R2 subunit, the tyrosine residue is Tyr177. Through the process of catalysis, it has been proposed that the oxidation equivalent stored in the tyrosil subunit is passed along a pathway to a cysteine residue at an active site. Both subunits act as electron transfer pathways to the iron site. An arginine residue, Arg 265, has proven to be key to the activity of this particular enzyme. <ref>http://www.jbc.org/cgi/content/full/281/36/26022</ref>
==Structual Properties==
While both forms of this enzyme both interact with iron, there are some structural differences due to the different conditions.
 
1w68:
16 α-helices
8 β-turns
 
1w69:
15 α-helices
10 β-turns<ref>http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/</ref>
 
==Protein Sequence==
For the enzyme under oxidizing conditions (1w68):
 
VEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFA
ASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVK
KKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
CLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR
VENPF
 
For the enzyme under reducing conditions(1w69):
 
VEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFA
ASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVK
KKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
CLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR
VENPF<ref>http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/</ref>
 
==References==
<references/>BLAST: Basic Local Alignment Search Tool, National Center for Biotechnology Information
<references/>Gräslund A, Narváez AJ, Thelander L, Voevodskaya N. 2006 "The Involvement of Arg265 of Mouse Ribonucleotide Reductase R2 Protein in Proton Transfer and Catalysis." J. Biol. Chem., 281(36): 26022-26028.

Latest revision as of 20:25, 18 October 2012

Please do NOT make changes to this Sandbox. Sandboxes 30-60 are reserved for use by Biochemistry 410 & 412 at Messiah College taught by Dr. Hannah Tims during Fall 2012 and Spring 2013.

Adenylate Kinase

Drag the structure with the mouse to rotate

Adenylate Kinase

Adenylate kinase is a enzyme that catalyzes the conversion of 2 units of ADP into a unit of ATP and a unit of AMP. It is because of this catalytic role that adenylate kinase is an important part of homeostasis. Consisting of only 211 amino acids, adenylate kinase is not that large of an enzyme, despite its vital role in metabolism.

Structure

The secondary structure of adenylate kinase shows alpha helices (blue) and beta sheets (teal) surrounding the non-hydrolysable substrate analogue. The enzyme is comprised of 9 helices and 9 sheets constituting the secondary structure. As with any enzyme, the hydrogen bonds (May not load) between the residues of the peptide chains supply the final folded protein with structural stability which helps hold it in its folded configuration.

This secondary structure is oriented as such so that the hydrophobic and hydrophilic residues are buried or exposed depending on their individual properties. The hydrophobic, represented in grey, are buried as to avoid as much contact with water as possible. Similarly, the hydrophilic, or polar, residues are colored purple and exposed as much to water as possible. This is further illustrated by the water solvation model, displaying water molecules as pink orbs and the enzyme as a translucent white. These hydrophobic interactions, burying of non polar residues and exposure of polar ones, is another main driving force conserving the tertiary structure of the enzyme.

The model of adenylate kinases shows displays the non-hydrolysable substrate as the ligand. The residues interacting with the ligand are polar as the substrate is also highly negatively charged. The ligand can be seen in the active site of the enzyme, and shown in standard atomic coloring scheme. The catalytic residues are the residues that directly interact with the ligand, and can be seen in yellow.