Sandbox Reserved 1099: Difference between revisions
From Proteopedia
Jump to navigationJump to search
No edit summary |
No edit summary |
||
| Line 16: | Line 16: | ||
Dermcidin gene (''DCD gene'') is located on the '''chromosome 12''' and constitutively expressed as '''precursor''' of 110 amino acids only in mucous cells of [https://en.wikipedia.org/wiki/Eccrine_sweat_gland_ eccrine sweat glands] within the dermis of the skin. The molecular weight of the DCD full-length sequence is 9.3 kDa including the signal peptide. The peptide is then secreted by granules in sweat and transported on the epidermal surface. | Dermcidin gene (''DCD gene'') is located on the '''chromosome 12''' and constitutively expressed as '''precursor''' of 110 amino acids only in mucous cells of [https://en.wikipedia.org/wiki/Eccrine_sweat_gland_ eccrine sweat glands] within the dermis of the skin. The molecular weight of the DCD full-length sequence is 9.3 kDa including the signal peptide. The peptide is then secreted by granules in sweat and transported on the epidermal surface. | ||
DCD full-length sequence : | |||
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL | |||
However, some clivage of the precursor occurred probably in sweat to produce different active forms of dermcidin peptide. The most abundant proteolytically processed DCD peptide presents in sweat is '''DCD-1L'''. | However, some clivage of the precursor occurred probably in sweat to produce different active forms of dermcidin peptide. The most abundant proteolytically processed DCD peptide presents in sweat is '''DCD-1L'''. | ||
