Sandbox Reserved 1661: Difference between revisions
From Proteopedia
Jump to navigationJump to search
Anaïs Kembou (talk | contribs) No edit summary |
Anaïs Kembou (talk | contribs) No edit summary |
||
| Line 10: | Line 10: | ||
Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa. | Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa. | ||
The '''primary structure''', corresponding to a sequence of amino acids, of the predominant somatotropin is the following : | The '''primary structure''', corresponding to a sequence of amino acids, of the predominant somatotropin is the following : | ||
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYS | |||
FLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSW | |||
LEPVGFLRSVFANQLVYGASDSDVYDLLKDLEEGIQTLMGRLE | |||
DGSPRTGQAFKGTYAKFDANSHNDDALLKNYGLLYCFRKDMDK | |||
VETFLRIVQCRSVEGSCGF | |||
<Structure load='1hgu' size='350' frame='true' align='right' caption='Representation of Somatotropin' /> | <Structure load='1hgu' size='350' frame='true' align='right' caption='Representation of Somatotropin' /> | ||