Sandbox Reserved 1661: Difference between revisions
From Proteopedia
Jump to navigationJump to search
Anaïs Kembou (talk | contribs) No edit summary |
Anaïs Kembou (talk | contribs) No edit summary |
||
| Line 9: | Line 9: | ||
== Structure == | == Structure == | ||
Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa. | Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa. | ||
The '''primary structure''', corresponding to a sequence of amino acids, of the predominant somatotropin is the following : | The '''primary structure''', corresponding to a sequence of amino acids, of the predominant somatotropin is the following : | ||
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYS | FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYS | ||
FLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSW | FLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSW | ||
