Sandbox Reserved 1661: Difference between revisions

From Proteopedia
Jump to navigationJump to search
No edit summary
No edit summary
Line 10: Line 10:
== Structure ==
== Structure ==
Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa.   
Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa.   
The '''primary structure''', corresponding to a sequence of amino acids, of the predominant somatotropin is the following :
The '''primary structure''', corresponding to a [https://www.uniprot.org/uniprot/P01241 sequence of amino acids], of the predominant somatotropin.


FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRI
SLLLIQSWLEPVGFLRSVFANQLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKGTYAKFDANSHNDDA
LLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF


Somatotropin does not exist as a linear chain of amino acids, it twists and folds on itself, forming the '''secondary structure'''. The protein, made up of a single chain, consists of four antiparallel aligned <scene name='86/868194/Alpha-helice/2'>α-helices</scene> in an up-up-down-down manner <ref name="Endokrynologika Polska">DOI:10.5603/EP.2013.0009</ref> [https://doi.org/10.1016/j.ghir.2013.02.002]. The first helix starts at the 6th amino acid, which is a leucine and ends with the 37th amino acid proline. It is separated from the other three helices after the 37th position. The 38th and 39th amino acids, which are lysine and glutamic acid are spliced out of the protein and therefore disconnects the first helix from the second one. The second helix starts at position 72 till 92, the third from 106 till 128 and the fourth helix from 154 until 184. All helices are ampipathic with strong <scene name='86/868194/Hydrophobic_regions/1'>hydrophobic regions</scene>, especially helix 2 is very hydrophobic. The [https://en.wikipedia.org/wiki/Hydrophobic_effect#:~:text=Structures%20of%20water%2Dsoluble%20proteins,interact%20with%20surrounding%20water%20molecules. hydrophobic protein core] is usually tigthly packed and any mutations in the hidden positions lead to destablilization <ref name="pubMed">PMID:17584122</ref>.  
Somatotropin does not exist as a linear chain of amino acids, it twists and folds on itself, forming the '''secondary structure'''. The protein, made up of a single chain, consists of four antiparallel aligned <scene name='86/868194/Alpha-helice/2'>α-helices</scene> in an up-up-down-down manner <ref name="Endokrynologika Polska">DOI:10.5603/EP.2013.0009</ref> [https://doi.org/10.1016/j.ghir.2013.02.002]. The first helix starts at the 6th amino acid, which is a leucine and ends with the 37th amino acid proline. It is separated from the other three helices after the 37th position. The 38th and 39th amino acids, which are lysine and glutamic acid are spliced out of the protein and therefore disconnects the first helix from the second one. The second helix starts at position 72 till 92, the third from 106 till 128 and the fourth helix from 154 until 184. All helices are ampipathic with strong <scene name='86/868194/Hydrophobic_regions/1'>hydrophobic regions</scene>, especially helix 2 is very hydrophobic. The [https://en.wikipedia.org/wiki/Hydrophobic_effect#:~:text=Structures%20of%20water%2Dsoluble%20proteins,interact%20with%20surrounding%20water%20molecules. hydrophobic protein core] is usually tigthly packed and any mutations in the hidden positions lead to destablilization <ref name="pubMed">PMID:17584122</ref>.  

Revision as of 16:47, 16 February 2021

Somatotropin (GH for Growth Hormone or HGH for Human Growth Hormone) is a polypeptide hormone produced by the somatotropic cells of the pituitary gland. The human growth hormone complex, a protein circulating in the blood, consists of five similiar genes located over a distance of 50 kbp on the long arm of chromosome 17 [1]. There it gets encoded by the Growth hormone 1 gene along with four other related genes (hGH-N, hCS-A, hCS-B, hGH-V [1], [1])[2]. Three of these genes are encoding human chorionic somatomammotropin, which is closely related to somatotropin. They are all in the same transcriptional orientation [2]. GH is one of the best known pleiotropic hormones [3].

Functions

Somatropin plays an important role in physiological environments such as: increasing muscle mass, reducing fat mass, providing the energy necessary for tissue growth, maintaining the right level of glucose and lipids and the development of the individual's body [3]. It acts directly on a cell surface or indirectly. In the second case, somatotropin stimulates tissues such as the liver, which in turn allows the synthesis and secretion of IGF-1, thus enabling the development of cell growth, tissue, bone and thus the linear growth of the individual.[4] The GH regulates direct or indirect anabolic and growth promoting actions. Through direct regulation GH increases the amino acid uptake, the RNA- ,protein- and cartilage-synthesis and muscle growth. These regulations are often mediated by IFG. [4] However, the GH is also able to regulate catabolic actions. Thus it stimulates the breakdown of lipids (lipolysis) as is evident by increased fatty acids. A lack of GH is therefore associated with an increased lipid deposit. [5] GH can be regulated by various factors. The hypothalamus secretes hormones, like the GH releasing factor (GHR) or hormone (GHRH) which can stimulate the pituitary cells and activate different signal transduction cascades. On the other hand, it produces the hormone Somatostatin (SS) which inhibits the GH secretion by blocking the adenylate cyclase (AC). However, not the GH expression. It can also prevent the release of GHRH fom the hypthalamus. In addition, can be inhibited by feedback regulation. It stimulates the steroid and thyroid synthesis which migrate back and inhibit GH. Other regulating factors are environmental influences and the nutritional state. [6]

Somatotropin : Growth Hormon (HGH)

Drag the structure with the mouse to rotate

Dieseas and treatments

Many diseases can be due to a dysfunction in the secretion of GH.

Dwarfism is characterized by a lack of GH. The reasons for this deficiency can be explained by many fact, as welle as : a dysfunction during foetal development,The inability of somatotropic cells to synthesize GH, an abnormal structure of the protein, making the connection to the receiver more difficult, geneics mutation ... These factors are then likely to lead to a slowdown in growth, cell, tissue, and bone development.[5]

Gigantism is characterised by the presence of a high level of GH or IGF-1. This pathology is most often due to an adenoma of the pituitary cells, responsible for the production of the hormone GHRH, which then stimulates the cells to produce GH in large quantities. It can also be explained by the fact that tissues that do not normally produce GH have tumour cells capable of producing GH. Acromegaly is when this excess of hormone occurs after puberty.[5]

Until 1985, injections of GH were carried out for people suffering from dwarfism. As it could only be obtained by extraction from the pituitary glands of dead people, it could only be extracted in small quantities, so resources were limited.[6] Also this therapeutic treatment has been stopped in many countries, due to the possible contamination of the hormone by prions, which can cause serious diseases such as Creutzfeldt-Jakob disease.[5] As a result, biosynthetic synthesis of the hormone is carried out by developing recombinant proteins of GH or IGF-1.[6]

Affected by gigantism pathology, individuals may have therapeutic radiation and therapeutic drug treatment or synthesis of inhibitors such as somatostatin,[5] which act as GH antagonists by binding to the receptor, thus preventing the GH to perform its functions.

References

  1. ↑ 1.0 1.1 Sami AJ. Structure-function relation of somatotropin with reference to molecular modeling. Curr Protein Pept Sci. 2007 Jun;8(3):283-92. doi: 10.2174/138920307780831820. PMID:17584122 doi:https://dx.doi.org/10.2174/138920307780831820
  2. ↑ Barsh GS, Seeburg PH, Gelinas RE. The human growth hormone gene family: structure and evolution of the chromosomal locus. Nucleic Acids Res. 1983 Jun 25;11(12):3939-58. doi: 10.1093/nar/11.12.3939. PMID:6306568 doi:https://dx.doi.org/10.1093/nar/11.12.3939
  3. ↑ Reh CS, Geffner ME. Somatotropin in the treatment of growth hormone deficiency and Turner syndrome in pediatric patients: a review. Clin Pharmacol. 2010;2:111-22. doi: 10.2147/CPAA.S6525. Epub 2010 Jun 1. PMID:22291494 doi:https://dx.doi.org/10.2147/CPAA.S6525
  4. ↑ Utiger, R. D. and other Encyclopedia Britannica Contributors (1998), Insulin-like growth factor. Science, Chemistry.
  5. ↑ 5.0 5.1 5.2 5.3 Utiger, R.D. and other Encyclopedia Britannica Contributors (1998), Growth hormone. Life cycle, processes & properties encyclopedia articles.
  6. ↑ 6.0 6.1 Dr. Abdi, M., Département de Génétique Moléculaire et Appliquée, Université des Sciences et de la Technologie d’Oran Mohamed BOUDIAF.