Sandbox 323: Difference between revisions
From Proteopedia
Jump to navigationJump to search
No edit summary |
No edit summary |
||
| Line 17: | Line 17: | ||
the 3DS8 protein was matched with a few proteases through right-handed superpositions with RMSD values ranging from 1.20-1.40, indicating relative similarities. | the 3DS8 protein was matched with a few proteases through right-handed superpositions with RMSD values ranging from 1.20-1.40, indicating relative similarities. | ||
The left-handed superpositions matched with more trypsins and displayed better RMSD values ranging from 0.93-1.11. | The left-handed superpositions matched with more trypsins and displayed better RMSD values ranging from 0.93-1.11. | ||
The 3DS8 protein did not have many very specific active site matches with known proteins on the Chimera software [2], however, it was very similar to trypsin, | The 3DS8 protein did not have many very specific active site matches with known proteins on the Chimera software [2], however, it was very similar to trypsin, | ||
alpha-chymotrypsin, and proteinase B. The function of 3DS8 is most likely very similar to those since the active sites have the same amino acids and structures that differ within <4 angstroms. | alpha-chymotrypsin, and proteinase B. The function of 3DS8 is most likely very similar to those since the active sites have the same amino acids and structures that differ within <4 angstroms. | ||
The Dali database [3] was used to determine the conserved sequences within the 3ds8 protein. The majority of the hits were lipases with Z-scores up to 31.8, meaning the proteins are homologous | The Dali database [3] was used to determine the conserved sequences within the 3ds8 protein. The majority of the hits were lipases with Z-scores up to 31.8, meaning the proteins are homologous | ||
| Line 25: | Line 27: | ||
these is conserved in the 4 selected protein matches, which means that the active site is conserved. The 3ds8 active site is conserved in many other proteins with similar functions, many of which | these is conserved in the 4 selected protein matches, which means that the active site is conserved. The 3ds8 active site is conserved in many other proteins with similar functions, many of which | ||
are lipases. Since the 3DS8 has so many structural similarities to lipases, it most likely has the same functionality as the known proteins. | are lipases. Since the 3DS8 has so many structural similarities to lipases, it most likely has the same functionality as the known proteins. | ||
The BLAST database [4] was utilized to search for similar gene sequences and corresponding residue patterns. Using the FASTA sequence, the 3DS8 sequence is matched with similar proteins in an | The BLAST database [4] was utilized to search for similar gene sequences and corresponding residue patterns. Using the FASTA sequence, the 3DS8 sequence is matched with similar proteins in an | ||
| Line 30: | Line 33: | ||
The 3DS8 protein is part of the superfamily of alpha-beta hydrolases, so it most likely has the same function. Many structural and sequential similarities are conserved between 3DS8 | The 3DS8 protein is part of the superfamily of alpha-beta hydrolases, so it most likely has the same function. Many structural and sequential similarities are conserved between 3DS8 | ||
and matched proteins, indicating that 3DS8 could very well be a hydrolase. | and matched proteins, indicating that 3DS8 could very well be a hydrolase. | ||
FASTA sequence of 3DS8: | FASTA sequence of 3DS8: | ||
KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLD | KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLD | ||
PNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK | PNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK | ||
InterPro Scan [5] searched for structure and taxonomy relations. The results have information about the domains and families of the protein. At the bottom, there are biological processes, | InterPro Scan [5] searched for structure and taxonomy relations. The results have information about the domains and families of the protein. At the bottom, there are biological processes, | ||
molecular functions, and cellular components to learn more about the protein and where it originates from. InterPro confirmed that 3DS8 is most likely a hydrolase. Since 3DS8 is part of | molecular functions, and cellular components to learn more about the protein and where it originates from. InterPro confirmed that 3DS8 is most likely a hydrolase. Since 3DS8 is part of | ||
the hydrolase superfamily, its structure and function are likely to be that of some sort of hydrolase. | the hydrolase superfamily, its structure and function are likely to be that of some sort of hydrolase. | ||
The last molecular modeling strategy was using SwissDock to investigate different ligands for 3DS8. Using the previously mentioned 4 residues that make up the active site, there were a few | The last molecular modeling strategy was using SwissDock to investigate different ligands for 3DS8. Using the previously mentioned 4 residues that make up the active site, there were a few | ||
ligands that demonstrated promising binding to 3DS8. The best choices would be PNP alpha-D-glucopyranoside or PNP N-acetyl-Beta-D-glucosaminide because they are close to the residues | ligands that demonstrated promising binding to 3DS8. The best choices would be PNP alpha-D-glucopyranoside or PNP N-acetyl-Beta-D-glucosaminide because they are close to the residues | ||
of the active site. | of the active site. | ||
The molecular weight of 3DS8 is proposed to be about 28 kDa. | The molecular weight of 3DS8 is proposed to be about 28 kDa. | ||
== Relevance == | == Relevance == | ||