Sandbox Reserved 996: Difference between revisions

Revision as of 23:36, 25 February 2015 view source Paul Thomas Morse (talk \| contribs) 81 edits No edit summary ← Older edit		Revision as of 23:37, 25 February 2015 view source Paul Thomas Morse (talk \| contribs) 81 edits No edit summary Newer edit →
Line 17:		Line 17:


	Sequence - α subunit		Sequence - α subunit
	GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL		GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL

Navigation menu