The hemopexin domain has two conserved cysteines that are disulfide bonded. Mutation of those cysteines to alanines <ref>PMID:8464863</ref> or reduction and alkylation destroys collagenolytic activity (K. Suzuki and H.Nagase, unpublished results).<ref name="Pdf"/>
The hemopexin domain has two conserved cysteines that are disulfide bonded. Mutation of those cysteines to alanines <ref>PMID:8464863</ref> or reduction and alkylation destroys collagenolytic activity (K. Suzuki and H.Nagase, unpublished results).<ref name="Pdf"/>
[http://www.jleukbio.org/content/81/4/870.full]
This domain is localized outside of the catalytic domain. It is essential for the substrate recognition of MMP-8 because this domain is removed, the protein loses its ability to cleave collagen. However, neutrophil collagenase is still able to cleave other substrate.
== Mechanism ==
== Mechanism ==
Revision as of 15:30, 28 January 2016
MMP8
MMP-8, also called, Neutrophil collagenase or Collagenase 2, is a zinc-dependent and calcium-dependent enzyme. It belongs to the matrix metalloproteinase (MMP) family which is involved in the breakdown of extracellular matrix in embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The gene coding this family is localized on the chromosome 11 of Homo sapiens .[1]
MMP8 is composed of several domains: a propeptide, a catalytic domain, a hinge region, and a C-terminal hemopexinlike domain.[2]
Thanks to X-ray crystallography, its structure has been solved with 1,7 Å resolution (2OY4).
Propeptide
It corresponds to 79 aminoacids, from Phe21 to Met100.
The sequence of residue is: FPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFM
The Zn ion which is involved in the catalytic activity is the Zn999. In a publication (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=2) which studies the catalytic domain of MMP8 thanks to the Pro-Leu-Gly-hydroxylamine inhibitor, this ion is penta-coordinated with: His197, His201 and His207 of MMP8 and with the carbonyl and the hydroxyl oxygen of the hydroxamic acid moiety of the inhibitor.
ZN pocket interaction
The residues involved in the Zn interactions are one Asp residue (149) next to three His residues (147, 162 and 175).
This enzyme binds 2ZN ions per subunit.
maintain a Zn2+ atom coordinated with three water molecules. One of them is as well bound to the Glu residue thanks to a hydrogen bond. The second Zn2+ atom is not involved in the active site. At first, the Gly 206 residue of the substrate binds the active site thanks to the Zn2+ atom. When it binds it takes the place of unstable water molecules and establishes stabilizing interactions with the active site thanks to its C terminal part. Then, the Ala 182 residue of the enzyme makes a hydrogen bond with the NH group of the substrate: this allows the substrate to enter the cavity of the catalytic site. The rest of the protein is stabilized by 4 hydrogen bonds with the amino acid located in the cavity.
The conserved cysteine present in the cysteine-switch motif (89-96) binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
Catalytic domain
This domain is composed of 163 residues, from Met80 to Gly242, organized in three alpha helixes and five beta sheets.
(https://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=1). The catalytic zinc ion is situated at the bottom of the active-site. The other zinc ion and the two calcium ions are packed against the top of the beta sheet and presumably function to stabilize the catalytic domain. The polypeptide folding and in particular the zinc environment of the collagenase catalytic domain bear a close ressemblance to the astacins and the snake venom metalloproteinases.
The catalytic domain alone has proteolytic activity against other protein substrates and synthetic substrates.
The hemopexin domain has two conserved cysteines that are disulfide bonded. Mutation of those cysteines to alanines [3] or reduction and alkylation destroys collagenolytic activity (K. Suzuki and H.Nagase, unpublished results).[2]
This domain is localized outside of the catalytic domain. It is essential for the substrate recognition of MMP-8 because this domain is removed, the protein loses its ability to cleave collagen. However, neutrophil collagenase is still able to cleave other substrate.
Mechanism
To express collagenolytic activity, they have to retain both the catalytic and hemopexin domains.
It is not clear how the hemopexin domain help to cleave triple-helical collagens because the isolated hemopexin domains of MMP-8 does not bind to collagen.[4]
The binding of collagenases to collagen must partially unwind triple helix to allow cleavage of the individual alpha chains. Since heat-denatured collagens (gelatins) are poorer substrates at 37°C [5], interaction of collagenase to interstitial collagen must induce conformational change in alpha chain of collagen that fits the substrate binding site of the catalytic domain, but the molecular basis of this mechanism is not known.
In this model the peptide lies antiparallel to the edge strand IV by forming a number of hydrogen bonds. The N-terminal Pro at P3 (the third residue on the left of the scissile bond) interacts with the hydrophobic cleft formed by side chains of His162, Ser151, and Phe164, whereas Leu at P2 (the second residue on the right of the scissile bond) interacts with a shallow groove lined by His201, Ala206 and His207. The dominant interactions between the peptide and the enzyme are made by the phenyl side chain of the inhibitor and the large hydrophobic S1' pocket (located to the right of the catalytic zinc) formed by side chains of His197, Val194, Tyr219, and the main chain segment of Pro217-Asn-Tyr219. The side chain of P2� Ala points away from the enzyme and the C-terminal, P3� Gly is located crossover segments Gly158-Leu160 and Pro217-Tyr219.
Cleavage at Gly775–Ile776 or Leu776. [6]
Function
Like all the MMPs, MMP8 is secreted as inactive proproteins and then activated after a cleavage by extracellular proteinases. Indeed, it can't be activated without removal of the activation peptide.
cleave the helical collagen molecule at a single Gly-Ile/Leu bond in each alpha-chain of the molecule. The cleavage generates fragments that spontaneously lose their helical conformation, denature to gelatin, and become soluble. The gelatin is then susceptible to attack by gelatinases and other proteases[7]
metalloendopeptidase activity = mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.[8]
Disease
Overexpression of MMP8, or inadequate control by TIMPs, can be associated with a lot of pathological conditions: psoriasis, sclerosis, osteoarthritis, rheumatoid arthritis, osteoporosis, Alzheimer's disease, tumor growh and metastasis.[9]
Relevance
Structural highlights
This is a sample scene created with SAT to color by Group, and another to make a transparent representation of the protein. You can make your own scenes on SAT starting from scratch or loading and editing one of these sample scenes.
↑Stams T, Spurlino JC, Smith DL, Wahl RC, Ho TF, Qoronfleh MW, Banks TM, Rubin B. Structure of human neutrophil collagenase reveals large S1' specificity pocket. Nat Struct Biol. 1994 Feb;1(2):119-23. PMID:7656015
↑Hirose T, Patterson C, Pourmotabbed T, Mainardi CL, Hasty KA. Structure-function relationship of human neutrophil collagenase: identification of regions responsible for substrate specificity and general proteinase activity. Proc Natl Acad Sci U S A. 1993 Apr 1;90(7):2569-73. PMID:8464863
↑Knauper V, Osthues A, DeClerck YA, Langley KE, Blaser J, Tschesche H. Fragmentation of human polymorphonuclear-leucocyte collagenase. Biochem J. 1993 May 1;291 ( Pt 3):847-54. PMID:8489511
↑Welgus HG, Jeffrey JJ, Eisen AZ. Human skin fibroblast collagenase. Assessment of activation energy and deuterium isotope effect with collagenous substrates. J Biol Chem. 1981 Sep 25;256(18):9516-21. PMID:6270090
↑Knauper V, Docherty AJ, Smith B, Tschesche H, Murphy G. Analysis of the contribution of the hinge region of human neutrophil collagenase (HNC, MMP-8) to stability and collagenolytic activity by alanine scanning mutagenesis. FEBS Lett. 1997 Mar 17;405(1):60-4. PMID:9094424