Sandbox Reserved 1125: Difference between revisions
From Proteopedia
Jump to navigationJump to search
No edit summary |
Laura Dutto (talk | contribs) No edit summary |
||
| Line 25: | Line 25: | ||
== Structure and domains == | == Structure and domains == | ||
MMP8 is composed of several domains: a propeptide, a catalytic domain, a hinge region, and a C-terminal hemopexinlike domain.<ref name="Pdf">[https://www.google.fr/url?sa=t&rct=j&q=&esrc=s&source=web&cd=5&cad=rja&uact=8&ved=0ahUKEwipxN6imszKAhVCPxoKHR5QDC4QFghFMAQ&url=http%3A%2F%2Fwww.springer.com%2Fcda%2Fcontent%2Fdocument%2Fcda_downloaddocument%2F9780896036680-c2.pdf%3FSGWID%3D0-0-45-494797-p173728219&usg=AFQjCNHRfP-tVHWXP2ljUTd3MjjhObqnCA&sig2=6RnjnFvqo7PVhxvSDDsOlw Substrate specificity of MMPs]</ref>. | :MMP8 is composed of several domains: a propeptide, a catalytic domain, a hinge region, and a C-terminal hemopexinlike domain.<ref name="Pdf">[https://www.google.fr/url?sa=t&rct=j&q=&esrc=s&source=web&cd=5&cad=rja&uact=8&ved=0ahUKEwipxN6imszKAhVCPxoKHR5QDC4QFghFMAQ&url=http%3A%2F%2Fwww.springer.com%2Fcda%2Fcontent%2Fdocument%2Fcda_downloaddocument%2F9780896036680-c2.pdf%3FSGWID%3D0-0-45-494797-p173728219&usg=AFQjCNHRfP-tVHWXP2ljUTd3MjjhObqnCA&sig2=6RnjnFvqo7PVhxvSDDsOlw Substrate specificity of MMPs]</ref>. | ||
=== Propeptide === | === Propeptide === | ||
| Line 31: | Line 31: | ||
The sequence of residue is: FPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFM | The sequence of residue is: FPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFM | ||
=== Ca2+ interactions === | === Catalytic domain === | ||
:Thanks to X-ray crystallography, the catalytic domain structure has been solved with 1,7 Å resolution (2OY4).This domain is composed of 157 residues, from Met86 to Gly242, organized in <scene name='71/719866/Helixes/3'>three alpha helixes</scene> and <scene name='71/719866/Sheets/2'>five beta sheets</scene>.The protein folding and especially the zinc environment of the collagenase catalytic domain is very close to the astacins and the snake venom metalloproteinases. The catalytic domain alone has proteolytic activity against other protein substrates and synthetic substrates.[http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=2] | |||
==== Ca2+ interactions ==== | |||
[[Image:CA_pocket_interaction.gif | thumb|CA996 pocket interaction]]This enzyme binds 3 Ca ions, 2 of them in the catalytic domain, which are packed against the top of the beta sheet and mostly have a structural function, stabilizing the catalytic domain. | [[Image:CA_pocket_interaction.gif | thumb|CA996 pocket interaction]]This enzyme binds 3 Ca ions, 2 of them in the catalytic domain, which are packed against the top of the beta sheet and mostly have a structural function, stabilizing the catalytic domain. | ||
The residues involved in the Ca996 interactions (coordinate bonds) are <scene name='71/719866/Ca2_interactions/1'>two Gly residues (169 and 171) next to two Asp residues (137 and 173)</scene>. | The residues involved in the Ca996 interactions (coordinate bonds) are <scene name='71/719866/Ca2_interactions/1'>two Gly residues (169 and 171) next to two Asp residues (137 and 173)</scene>. | ||
=== Zn2+ interactions === | ==== Zn2+ interactions ==== | ||
The zinc-binding motif HEXGHXXGXXH presents in the catalytic domain is characteristic for the protease activity of MMP-8. | The zinc-binding motif HEXGHXXGXXH presents in the catalytic domain is characteristic for the protease activity of MMP-8. | ||
==== Zn999 : the catalytic zinc ==== | ===== Zn999 : the catalytic zinc ===== | ||
It is involved in the catalytic activity and is situated at the bottom of the active-site. In a publication [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=2] which studies the catalytic domain of MMP8 thanks to the Pro-Leu-Gly-hydroxylamine inhibitor, this ion is penta-coordinated with: His197, His201 and His207 of MMP8 and with the carbonyl and the hydroxyl oxygen of the hydroxamic acid moiety of the inhibitor. On this <scene name='71/719866/Zn999_interactions/2'>link</scene> you can only see the 3 His of MMP8 with the Zn999. The fourth ligand of the catalytic zinc is a water molecule. | It is involved in the catalytic activity and is situated at the bottom of the active-site. In a publication [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=2] which studies the catalytic domain of MMP8 thanks to the Pro-Leu-Gly-hydroxylamine inhibitor, this ion is penta-coordinated with: His197, His201 and His207 of MMP8 and with the carbonyl and the hydroxyl oxygen of the hydroxamic acid moiety of the inhibitor. On this <scene name='71/719866/Zn999_interactions/2'>link</scene> you can only see the 3 His of MMP8 with the Zn999. The fourth ligand of the catalytic zinc is a water molecule. | ||
[[Image:ZN pocket interaction.gif | thumb|ZN999 pocket interaction]] | [[Image:ZN pocket interaction.gif | thumb|ZN999 pocket interaction]] | ||
==== Zn998 : the structural zinc ==== | ===== Zn998 : the structural zinc ===== | ||
The residues involved in the Zn998 interactions are <scene name='71/719866/Zn998/1'>an Asp residue (149) next to three His residues (147, 162 and 175)</scene>. The glutamic acid adjacent to the first histidine is essential for catalysis. It's good to know that W Bode and al.[http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=2] were unable to exchange or remove this Zinc in their crystals, which is suggesting that there is a tight interaction with MMP-8. | The residues involved in the Zn998 interactions are <scene name='71/719866/Zn998/1'>an Asp residue (149) next to three His residues (147, 162 and 175)</scene>. The glutamic acid adjacent to the first histidine is essential for catalysis. It's good to know that W Bode and al.[http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=2] were unable to exchange or remove this Zinc in their crystals, which is suggesting that there is a tight interaction with MMP-8. | ||