Sandbox Reserved 1099

From Proteopedia
Jump to navigationJump to search
This Sandbox is Reserved from 25/11/2019, through 30/9/2020 for use in the course "Structural Biology" taught by Bruno Kieffer at the University of Strasbourg, ESBS. This reservation includes Sandbox Reserved 1091 through Sandbox Reserved 1115.
To get started:
  • Click the edit this page tab at the top. Save the page after each step, then edit it again.
  • show the Scene authoring tools, create a molecular scene, and save it. Copy the green link into the page.
  • Add a description of your scene. Use the buttons above the wikitext box for bold, italics, links, headlines, etc.

More help: Help:Editing

Dermcidin is a Human antimicrobial, anionic and ion membrane channel (2YMK) discovered in 2001 based on 6 dermcidin antimicrobial peptides of 110 amino acids present in sweat. Dermcidin expands with other antimicrobial peptides the natural role of the skin to form a barrier to non-human invaders. These peptides, encoded by the DCD gene, play a role in the host defense system as a trimeric channel and thus, are able to prevent infection after injuries or any skin disorders. Scientists are focused on this molecule due to his charge particularity and since antibiotic resistances have been observed.

Homology

The dermcidin peptide sequence has no homology with other known antimicrobial peptide(shortened to AMP). There are two types of AMP, the anionic antimicrobial peptide (AAMP) and the cationic one (CAMP). These two AMP are completing themselves as they are at their optimum under different conditions. Despite AAMP are rare and infrequent in humans, dermcidin is the one of the most analysed AAMP.

Two classes of mammalian and cationic antimicrobial peptides exist:

Still, some size and structural similarities can be found with the defensin family.[1]

Expression and maturation

Dermcidin gene (DCD gene) is located on the chromosome 12 and constitutively expressed as precursor of 110 amino acids only in mucous cells of eccrine sweat glands within the dermis of the skin. The molecular weight of the DCD full-length sequence is 9.3 kDa including the signal peptide (in italic). The peptide is then secreted by granules in sweat and transported to the epidermal surface.

DCD full-length sequence: MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL [1]

However, some cleavage of the precursor occurres probably in sweat to produce different active forms of dermcidin peptide. The most abundant proteolytically processed DCD peptide present in sweat is DCD-1L (amino acid sequence in bold).

DCD-1L is created by proteases in sweat after the first post-secretory processing step consisting to reduce the peptide to the C-terminal thereupon containing 48 residues, from the 63 to the 110 amino acid. And secondly, the cathepsin D with 1,10-phenthroline-sensitive carboxypeptidase still not cited in sweat composition yet and an unidentified endoprotease contribute to further processed the DCD-1L C-terminal to produce other derived-peptides (12 have been discovered)[2]. One of them is DCD-1 which lacks the last leucine.

Structural highlights

Structure of the Dermicidin in the PDB.

Drag the structure with the mouse to rotate

Dermcidin is an anionic channel composed of 6 DCD peptides organized in 3 antiparallel peptide dimers and has a dimension of about 8x4 nm.[3] A DCD peptide has a secondary structure of a single α-helix.

Monomer

A monomer is a dimer formed by 2 elongated α-helix tied with 2 zinc ions. These Zn2+ ions are linked by N- and C-terminal residues from each α-helix. Residues involved are charged amino acids such as Glu 5, Asp 9, His 38 and Asp 42 [3]. That is why the N-terminal is cationic whereas the C-terminal is anionic.

Assembly of three monomers

The trimer is formed by salt bridges between 3 subunits. These bonds based on the zipper structure are managed again by the negatively (in blue) and positively (in red) charged residues, hence hydrophilic residues. Polar (in pink) amino acids can be also localized in the bond area neglecting positive amino acids. In total, 96 residues are ionizable which are all facing toward the interior of the tunnel forming five girdles : I,II,III,II,I as they are alternating negative (in blue) and positive (in red) charges.[3] They create a channel with an overall charge of -12 because DCD-1L peptide is -2.

The amino acids pointing toward the exterior are hydrophobic (in grey) because they are able to interact with the acyl chain of the membrane. They play a role in the cell membrane insertion.[4]

The bonds between monomers allow the formation of 6 lateral openings of a diameter of 1 nm (in purple) responsible of ions crossings. The presence of polar residues may have an impact on the selection of ion entry.[3]

The zinc cofactors

The majority of zinc ions found in sweat particularly are divalent zinc ions. Their presence is fundamental since the lack of these ions results in the inability of dermcidin to form a channel. The high permeability for water and conductance of the channel is also established by Zn2+.[3]

Antimicrobial activity

Dermcidin is present in the sweat around 1-10 µg/ml and acts like a regulator of the skin flora in the innate immune response by inhibiting a large range of bacteria (comprising Gram positive and Gram negative) and even fungus. Indeed, microbiology tests showed antimicrobial activity against Escherichia coli, Staphylococcus aureus and Enterococcus faecalis additional high fungicidal activity on Candida albicans Cite error: Closing </ref> missing for <ref> tag However, more recently studies revealed new information[3], namely, it was also detected that DCD-1L creates ion channels into the bacterial membranes promoted by Zn2+.[5] The complex process of forming such a channel starts with a flat approach to the bacterial membrane. Zn2+ stabilizes the slow formation of oligomeric complexes and coordinates the His38 residue. A break up of the oligomeric complex follows, leading to a membrane insertion and ending with a re-oligomerization so that the channel is formed.[6] Another study found further evidence for the membrane insertion but only of the cationic N-terminus of DCD-1L with K6 and K13 could being involved in the channel formation.[4] Finally, computer simulations were able to show that the channel allows aquaporine-like characterstics but with 50-fold higher osmotic water permeability coefficients. This leads to a high-conductive channel which creates a flux of mainly anions across the bacterial membrane. In a time scale of less than one second the pivotal transmembrane potential of bacteria will abrogate caused by only a few channels.[3]

Related diseases

Skin disorders

Some skin disorders such as psoriasis are compensate by an overexpression and overproduction of the antimicrobial peptides. The results are that there are less infections on the injured skin.[7]

Atopic dermatitis is also linked to DCD peptides. A study proved that patients suffering from this skin disorder have reduced amount of these peptides which could provoke skin infections in contrast to psoriasis [5].

Cancer related diseases

Dermcidin is related to certain cancer diseases such as prostatic cancer[8], lung cancer[9][10], melanoma[11][12], breast cancer[13][14] and hepatocellular carcinoma.[15][16] Furthermore, it plays a role in lymph node metastasis and gastric cancer.

The gastric cancer is characterized by an overexpression of long non coding RNAs (lncRNA) of stomach cancer associated transcript 3 (shortened as STCAT3). These RNAs, under the RNA form, run some functions of genes regulation such as gene expressions, control of the cell cycle, ect… Not only Dermicidin has been identified as the binding protein of lncRNA STCAT3, but also the Dermicidin expression has been shown stronger in the case of gastric cancer cells. So in the cancer cells the DCD can be found more abundant than in non-cancer cells. It can be used in the researches on the gastric cancer, hence to save lives.[17]

Often times, dermcidin is in the discussion to function as a general biomarker for the above mentioned diseases but also being a potential target for anticancer drugs such as seriniquinone.[12] The anticancer effect could derive from direct interaction or from protein complexes linked via disulfide bonds to DCD, which was already shown for Hsp70. In the survival-promoting peptide area of dermcidin, GNPCH is considered to be an ATP-dependent binding-site for Hsp70.[18]

References

  1. ↑ 1.0 1.1 Birgit Schittek, Rainer Hipfel, Birgit Sauer, Jürgen Bauer, Hubert Kalbacher, Stefan Stevanovic, Markus Schirle, Kristina Schroeder, Nikolaus Blin, Friedegund Meier, Gernot Rassner & Claus Garbe. "Dermcidin: a novel human antibiotic peptide secreted by sweat glands" Nature Immunology 2, no. 12 (December, 2001): 1133-37. https://doi.org/10.1038/ni732
  2. ↑ Daniel Baechle, Thomas Flad, Alexander Cansier, Heiko Steffen, Birgit Schittek, Jonathan Tolson, Timo Herrmann, Hassan Dihazi􏰀, Alexander Beck, Gerhard A. Mueller􏰀, Margret Mueller, Stefan Stevanovic, Claus Garbe, Claudia A. Mueller, and Hubert Kalbacher. "Cathepsin D Is Present in Human Eccrine Sweat and Involved in the Postsecretory Processing of the Antimicrobial Peptide DCD-1L" J. Biol. Chem. 281, no. 9 (March 3, 2006): 5406-15. https://doi.org/10.1074/jbc.M504670200
  3. ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 Song, C. et al. "Crystal Structure and Functional Mechanism of a Human Antimicrobial Membrane Channel." PNAS 110, no. 12 (March 19, 2013): 4586-591. https://doi.org/10.1073/pnas.1214739110
  4. ↑ 4.0 4.1 Van Sang Nguyen, Kang Wei Tan, Karthik Ramesh, Fook Tim Chew & Yu Keung Mok. "Structural basis for the bacterial membrane insertion of dermcidin" Nature Scientific reports 7 : 13923 (2017). https://doi.org/10.1038/s41598-017-13600-z
  5. ↑ 5.0 5.1 Paulmann, M., Arnold, T., Linke, D., Özdirekcan, S., Kopp, A., Gutsmann, T., Kalbacher, H., Wanke, I., Schuenemann, V.J., Habeck, M., Bürck, J., Ulrich, A.S., Schittek, B., 2012. Structure-Activity Analysis of the Dermcidin-derived Peptide DCD-1L, an Anionic Antimicrobial Peptide Present in Human Sweat. J. Biol. Chem. 287, 8434–8443. https://doi.org/10.1074/jbc.M111.332270
  6. ↑ Burian, M., Schittek, B., 2015. The secrets of dermcidin action. International Journal of Medical Microbiology 305, 283–286. https://doi.org/10.1016/j.ijmm.2014.12.012
  7. ↑ Harder, J., Bartels, J., Christophers, E., Schröder, J.-M., 1997. A peptide antibiotic from human skin. Nature 387, 861–861. https://doi.org/10.1038/43088
  8. ↑ Stewart, G.D., Lowrie, A.G., Riddick, A.C.P., Fearon, K.C.H., Habib, F.K., Ross, J.A., 2007. Dermcidin expression confers a survival advantage in prostate cancer cells subjected to oxidative stress or hypoxia. Prostate 67, 1308–1317. https://doi.org/10.1002/pros.20618
  9. ↑ Chang, W.C., Huang, M.S., Yang, C.J., Wang, W.Y., Lai, T.C., Hsiao, M., Chen, C.H., 2010. Dermcidin identification from exhaled air for lung cancer diagnosis. European Respiratory Journal 35, 1182–1185. https://doi.org/10.1183/09031936.00169509
  10. ↑ López-Sánchez, L.M., Jurado-Gámez, B., Feu-Collado, N., Valverde, A., Cañas, A., Fernández-Rueda, J.L., Aranda, E., Rodríguez-Ariza, A., 2017. Exhaled breath condensate biomarkers for the early diagnosis of lung cancer using proteomics. American Journal of Physiology-Lung Cellular and Molecular Physiology 313, L664–L676. https://doi.org/10.1152/ajplung.00119.2017
  11. ↑ Ortega-Martínez, I., Gardeazabal, J., Erramuzpe, A., Sanchez-Diez, A., Cortés, J., García-Vázquez, M.D., Pérez-Yarza, G., Izu, R., Luís Díaz-Ramón, J., de la Fuente, I.M., Asumendi, A., Boyano, M.D., 2016. Vitronectin and dermcidin serum levels predict the metastatic progression of AJCC I-II early-stage melanoma: Vitronectin and dermcidin serum levels in melanoma. Int. J. Cancer 139, 1598–1607. https://doi.org/10.1002/ijc.30202
  12. ↑ 12.0 12.1 Trzoss, L., Fukuda, T., Costa-Lotufo, L.V., Jimenez, P., La Clair, J.J., Fenical, W., 2014. Seriniquinone, a selective anticancer agent, induces cell death by autophagocytosis, targeting the cancer-protective protein dermcidin. Proceedings of the National Academy of Sciences 111, 14687–14692. https://doi.org/10.1073/pnas.1410932111
  13. ↑ Bancovik, J., Moreira, D.F., Carrasco, D., Yao, J., Porter, D., Moura, R., Camargo, A., Fontes-Oliveira, C.C., Malpartida, M.G., Carambula, S., Vannier, E., Strauss, B.E., Wakamatsu, A., Alves, V.A., Logullo, A.F., Soares, F.A., Polyak, K., Belizário, J.E., 2015. Dermcidin exerts its oncogenic effects in breast cancer via modulation of ERBB signaling. BMC Cancer 15, 70. https://doi.org/10.1186/s12885-015-1022-6
  14. ↑ Brauer, H.A., D’Arcy, M., Libby, T.E., Thompson, H.J., Yasui, Y.Y., Hamajima, N., Li, C.I., Troester, M.A., Lampe, P.D., 2014. Dermcidin expression is associated with disease progression and survival among breast cancer patients. Breast Cancer Res Treat 144, 299–306. https://doi.org/10.1007/s10549-014-2880-3
  15. ↑ Ross, J., 2011. Proteolysis-inducing factor core peptide mediates dermcidin-induced proliferation of hepatic cells through multiple signalling networks. Int J Oncol. https://doi.org/10.3892/ijo.2011.1064
  16. ↑ Shen, S.-L., Qiu, F.-H., Dayarathna, T.K., Wu, J., Kuang, M., Li, S.S.-C., Peng, B.-G., Nie, J., 2011. Identification of Dermcidin as a novel binding protein of Nck1 and characterization of its role in promoting cell migration. Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease 1812, 703–710. https://doi.org/10.1016/j.bbadis.2011.03.004
  17. ↑ Zhang, J., Ding, W., Kuai, X., Ji, Y., Zhu, Z., Mao, Z., Wang, Z., 2018. Dermcidin as a novel binding protein of lncRNA STCAT3 and its effect on prognosis in gastric cancer. Oncol Rep. https://doi.org/10.3892/or.2018.6673
  18. ↑ Stocki, P., Wang, X.N., Morris, N.J., Dickinson, A.M., 2011. HSP70 Natively and Specifically Associates with an N-terminal Dermcidin-derived Peptide That Contains an HLA-A*03 Antigenic Epitope. J. Biol. Chem. 286, 12803–12811. https://doi.org/10.1074/jbc.M110.179630