User:Michael Strong/H1N1/HA/MSA

From Proteopedia

Jump to: navigation, search

H1N1 Swine Flu Multiple Sequence Alignment of HA Protein, 68 sequences

HA Homology Model, Mexico Strain, A/Mexico/InDRE4487/2009, residues 16-341, 83% sequence identity to pdp template 3gbn


Protein Polymorphism Strain with Polymorphism Number of Strains with Polymorphism
HA V7I 237624327_A/swine/Alberta/O 1
HA L8M 227831776_A/California/06/2 5
HA A13T 229536010_A/Kansas/03/2009 1
HA N48D 229536049_A/Arizona/02/2009 1
HA L49I 229535997_A/South_Carolina/ 2
HA I96V 229598877_A/Ohio/07/2009 1
HA S100P 229535949_A/California/04/2 5
HA N104K 229892708_A/Canada-AB/RV153 1
HA V125M 229598896_A/Texas/15/2009 2
HA V149I 229536088_A/Indiana/09/2009 1
HA A214T 229535949_A/California/04/2 2
HA Y215N 237624327_A/swine/Alberta/O 1
HA S220T 229396494_A/Ohio/07/2009 21
HA F227L 229598896_A/Texas/15/2009 1
HA D239G 229892706A/Mexico/InDRE4114 1
HA D291E 229535997_A/South_Carolina/ 2
HA N293D 229783398_A/New_York/1682/2 1
HA V338I 229535949_A/California/04/2 5
HA A351V 237624327_A/swine/Alberta/O 1
HA I400V 229484027_A/Canada-NS/RV153 3
HA V428I 229598877_A/Ohio/07/2009 4
HA V444I 237511819_A/Mexico/4108/200 1
HA I527F 229892706A/Mexico/InDRE4114 1

gi|229396357_A/New_York/12/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892708_A/Canada-AB/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396399_A/New_York/18/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536064_A/New_York/20/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536055_A/New_York/20/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396487_A/New_York/19/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227977099_A/New_York/19/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396410_A/New_York/31/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396419_A/New_York/23/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396381_A/New_York/11/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396443_A/New_York/10/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229484031_A/Canada-ON/RV152      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535797_A/New_York/22/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536129_A/New_York/13/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536100_A/Massachusetts/0      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535909_A/Massachusetts/0      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535834_A/California/14/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892704_A/Canada-ON/RV152      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229598877_A/Ohio/07/2009         MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396504_A/Ohio/07/2009         MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396494_A/Ohio/07/2009         MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892702_A/Canada-ON/RV152      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229783398_A/New_York/1682/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511819_A/Mexico/4108/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536049_A/Arizona/02/2009      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVDLL 50
gi|229536088_A/Indiana/09/2009      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229484027_A/Canada-NS/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892700_A/Canada-NS/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229892710_A/Canada-NS/RV153      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511821_A/Mexico/4115/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511811_A/Mexico/4482/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511799_A/Mexico/4486/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511817_A/Mexico/4603/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|237511795_A/Mexico/4604/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229783367_A/Korea/01/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229783377_A/New_York/1669/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536022_A/Arizona/01/2009      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536003_A/Kansas/02/2009       MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536121_A/Michigan/02/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229598896_A/Texas/15/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229609563_A/Catalonia/P154/      -------------------------ANNSTDTVDTVLEKNVTVTHSVNLL 25
gi|229299521_A/Texas/04/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228860929_A/Netherlands/602      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229484029_A/Mexico/InDRE448      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535997_A/South_Carolina/      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNIL 50
gi|229609557_A/Catalonia/P148/      ------------------------HANNSTDTVDTVLEKNVTVTHSVNIL 26
gi|229299515_A/Texas/04/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229396467_A/Texas/06/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535816_A/Texas/09/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535985_A/Texas/08/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536075_A/Texas/07/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229368677_A/Denmark/513/200      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831826_A/Texas/04/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831774_A/Texas/05/2009        MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831776_A/California/06/2      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227831759_A/California/05/2      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227977104_A/California/10/2      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536135_A/Colorado/03/200      MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228481046_A/Auckland/1/2009      ------------------------------------------VTHSVNLL 8
gi|237624327_A/swine/Alberta/O      MKAILVIMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229536010_A/Kansas/03/2009       MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228495370_A/Regensburg/Germ      ----------------------------------------VTVTHSVNLL 10
gi|229892706A/Mexico/InDRE4114      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229535949_A/California/04/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227809830_A/California/04/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|229299517_A/California/07/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|228017758_A/California/08/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
gi|227977172_A/California/07/2      MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50
                                                                              *****::*

gi|229396357_A/New_York/12/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892708_A/Canada-AB/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396399_A/New_York/18/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536064_A/New_York/20/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536055_A/New_York/20/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396487_A/New_York/19/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227977099_A/New_York/19/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396410_A/New_York/31/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396419_A/New_York/23/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396381_A/New_York/11/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396443_A/New_York/10/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229484031_A/Canada-ON/RV152      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535797_A/New_York/22/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536129_A/New_York/13/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536100_A/Massachusetts/0      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535909_A/Massachusetts/0      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535834_A/California/14/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892704_A/Canada-ON/RV152      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229598877_A/Ohio/07/2009         EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYVVETS 100
gi|229396504_A/Ohio/07/2009         EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396494_A/Ohio/07/2009         EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892702_A/Canada-ON/RV152      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229783398_A/New_York/1682/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511819_A/Mexico/4108/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536049_A/Arizona/02/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536088_A/Indiana/09/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229484027_A/Canada-NS/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892700_A/Canada-NS/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229892710_A/Canada-NS/RV153      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511821_A/Mexico/4115/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511811_A/Mexico/4482/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511799_A/Mexico/4486/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511817_A/Mexico/4603/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|237511795_A/Mexico/4604/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229783367_A/Korea/01/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229783377_A/New_York/1669/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536022_A/Arizona/01/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536003_A/Kansas/02/2009       EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536121_A/Michigan/02/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229598896_A/Texas/15/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229609563_A/Catalonia/P154/      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 75
gi|229299521_A/Texas/04/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|228860929_A/Netherlands/602      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229484029_A/Mexico/InDRE448      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535997_A/South_Carolina/      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229609557_A/Catalonia/P148/      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 76
gi|229299515_A/Texas/04/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229396467_A/Texas/06/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535816_A/Texas/09/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535985_A/Texas/08/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536075_A/Texas/07/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229368677_A/Denmark/513/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831826_A/Texas/04/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831774_A/Texas/05/2009        EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831776_A/California/06/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227831759_A/California/05/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|227977104_A/California/10/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536135_A/Colorado/03/200      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|228481046_A/Auckland/1/2009      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 58
gi|237624327_A/swine/Alberta/O      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229536010_A/Kansas/03/2009       EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|228495370_A/Regensburg/Germ      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 60
gi|229892706A/Mexico/InDRE4114      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETS 100
gi|229535949_A/California/04/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|227809830_A/California/04/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|229299517_A/California/07/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|228017758_A/California/08/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
gi|227977172_A/California/07/2      EDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETP 100
                                    *********************************************:***.

gi|229396357_A/New_York/12/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892708_A/Canada-AB/RV153      SSDKGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396399_A/New_York/18/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536064_A/New_York/20/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536055_A/New_York/20/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396487_A/New_York/19/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227977099_A/New_York/19/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396410_A/New_York/31/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396419_A/New_York/23/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396381_A/New_York/11/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396443_A/New_York/10/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229484031_A/Canada-ON/RV152      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535797_A/New_York/22/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536129_A/New_York/13/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536100_A/Massachusetts/0      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535909_A/Massachusetts/0      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535834_A/California/14/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892704_A/Canada-ON/RV152      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229598877_A/Ohio/07/2009         SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHXSNKGVT 150
gi|229396504_A/Ohio/07/2009         SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396494_A/Ohio/07/2009         SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892702_A/Canada-ON/RV152      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229783398_A/New_York/1682/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511819_A/Mexico/4108/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536049_A/Arizona/02/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536088_A/Indiana/09/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGIT 150
gi|229484027_A/Canada-NS/RV153      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892700_A/Canada-NS/RV153      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229892710_A/Canada-NS/RV153      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511821_A/Mexico/4115/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511811_A/Mexico/4482/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511799_A/Mexico/4486/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511817_A/Mexico/4603/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|237511795_A/Mexico/4604/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229783367_A/Korea/01/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229783377_A/New_York/1669/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536022_A/Arizona/01/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536003_A/Kansas/02/2009       SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536121_A/Michigan/02/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229598896_A/Texas/15/2009        SSDNGTCYPGDFIDYEELREQLSSMSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229609563_A/Catalonia/P154/      SSDNGTCYPGDFIDYEELREQLSSMSSFERFEIFPKTSSWPNHDSNKGVT 125
gi|229299521_A/Texas/04/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228860929_A/Netherlands/602      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229484029_A/Mexico/InDRE448      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535997_A/South_Carolina/      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229609557_A/Catalonia/P148/      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 126
gi|229299515_A/Texas/04/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229396467_A/Texas/06/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535816_A/Texas/09/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535985_A/Texas/08/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536075_A/Texas/07/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229368677_A/Denmark/513/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831826_A/Texas/04/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831774_A/Texas/05/2009        SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831776_A/California/06/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227831759_A/California/05/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227977104_A/California/10/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536135_A/Colorado/03/200      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228481046_A/Auckland/1/2009      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 108
gi|237624327_A/swine/Alberta/O      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229536010_A/Kansas/03/2009       SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228495370_A/Regensburg/Germ      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 110
gi|229892706A/Mexico/InDRE4114      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229535949_A/California/04/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227809830_A/California/04/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|229299517_A/California/07/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|228017758_A/California/08/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
gi|227977172_A/California/07/2      SSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVT 150
                                    ***:********************:****************** ****:*

gi|229396357_A/New_York/12/200      XACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892708_A/Canada-AB/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396399_A/New_York/18/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536064_A/New_York/20/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536055_A/New_York/20/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396487_A/New_York/19/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227977099_A/New_York/19/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396410_A/New_York/31/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396419_A/New_York/23/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396381_A/New_York/11/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396443_A/New_York/10/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229484031_A/Canada-ON/RV152      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535797_A/New_York/22/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536129_A/New_York/13/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536100_A/Massachusetts/0      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535909_A/Massachusetts/0      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535834_A/California/14/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892704_A/Canada-ON/RV152      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229598877_A/Ohio/07/2009         AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396504_A/Ohio/07/2009         AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396494_A/Ohio/07/2009         AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892702_A/Canada-ON/RV152      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229783398_A/New_York/1682/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511819_A/Mexico/4108/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536049_A/Arizona/02/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536088_A/Indiana/09/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229484027_A/Canada-NS/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892700_A/Canada-NS/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229892710_A/Canada-NS/RV153      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511821_A/Mexico/4115/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511811_A/Mexico/4482/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511799_A/Mexico/4486/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511817_A/Mexico/4603/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|237511795_A/Mexico/4604/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229783367_A/Korea/01/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229783377_A/New_York/1669/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536022_A/Arizona/01/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536003_A/Kansas/02/2009       AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536121_A/Michigan/02/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229598896_A/Texas/15/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229609563_A/Catalonia/P154/      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 175
gi|229299521_A/Texas/04/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228860929_A/Netherlands/602      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229484029_A/Mexico/InDRE448      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535997_A/South_Carolina/      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229609557_A/Catalonia/P148/      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 176
gi|229299515_A/Texas/04/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229396467_A/Texas/06/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535816_A/Texas/09/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535985_A/Texas/08/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536075_A/Texas/07/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229368677_A/Denmark/513/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831826_A/Texas/04/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831774_A/Texas/05/2009        AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831776_A/California/06/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227831759_A/California/05/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227977104_A/California/10/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536135_A/Colorado/03/200      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228481046_A/Auckland/1/2009      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 158
gi|237624327_A/swine/Alberta/O      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229536010_A/Kansas/03/2009       AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228495370_A/Regensburg/Germ      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 160
gi|229892706A/Mexico/InDRE4114      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229535949_A/California/04/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227809830_A/California/04/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|229299517_A/California/07/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|228017758_A/California/08/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
gi|227977172_A/California/07/2      AACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPS 200
                                     *************************************************

gi|229396357_A/New_York/12/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892708_A/Canada-AB/RV153      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396399_A/New_York/18/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536064_A/New_York/20/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536055_A/New_York/20/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396487_A/New_York/19/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227977099_A/New_York/19/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396410_A/New_York/31/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396419_A/New_York/23/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396381_A/New_York/11/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396443_A/New_York/10/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229484031_A/Canada-ON/RV152      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535797_A/New_York/22/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536129_A/New_York/13/200      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536100_A/Massachusetts/0      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535909_A/Massachusetts/0      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535834_A/California/14/2      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892704_A/Canada-ON/RV152      TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229598877_A/Ohio/07/2009         TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396504_A/Ohio/07/2009         TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396494_A/Ohio/07/2009         TSADQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892702_A/Canada-ON/RV152      TSADQQSLYQNADAYVFVGXSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229783398_A/New_York/1682/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511819_A/Mexico/4108/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536049_A/Arizona/02/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536088_A/Indiana/09/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229484027_A/Canada-NS/RV153      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892700_A/Canada-NS/RV153      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229892710_A/Canada-NS/RV153      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511821_A/Mexico/4115/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511811_A/Mexico/4482/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511799_A/Mexico/4486/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511817_A/Mexico/4603/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|237511795_A/Mexico/4604/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229783367_A/Korea/01/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229783377_A/New_York/1669/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536022_A/Arizona/01/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536003_A/Kansas/02/2009       TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536121_A/Michigan/02/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229598896_A/Texas/15/2009        TSADQQSLYQNADAYVFVGSSRYSKKLKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229609563_A/Catalonia/P154/      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 225
gi|229299521_A/Texas/04/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228860929_A/Netherlands/602      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229484029_A/Mexico/InDRE448      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535997_A/South_Carolina/      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229609557_A/Catalonia/P148/      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 226
gi|229299515_A/Texas/04/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229396467_A/Texas/06/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535816_A/Texas/09/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229535985_A/Texas/08/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536075_A/Texas/07/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229368677_A/Denmark/513/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831826_A/Texas/04/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831774_A/Texas/05/2009        TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831776_A/California/06/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227831759_A/California/05/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227977104_A/California/10/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536135_A/Colorado/03/200      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228481046_A/Auckland/1/2009      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 208
gi|237624327_A/swine/Alberta/O      TSADQQSLYQNADANVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229536010_A/Kansas/03/2009       TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228495370_A/Regensburg/Germ      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 210
gi|229892706A/Mexico/InDRE4114      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRGQEGRMNYYWTL 250
gi|229535949_A/California/04/2      TSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227809830_A/California/04/2      TSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|229299517_A/California/07/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|228017758_A/California/08/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTL 250
gi|227977172_A/California/07/2      TSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRXXEGRMNYYWTL 250
                                    *************: **** ******:***********  **********

gi|229396357_A/New_York/12/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892708_A/Canada-AB/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396399_A/New_York/18/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536064_A/New_York/20/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536055_A/New_York/20/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396487_A/New_York/19/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227977099_A/New_York/19/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396410_A/New_York/31/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396419_A/New_York/23/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396381_A/New_York/11/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396443_A/New_York/10/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229484031_A/Canada-ON/RV152      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535797_A/New_York/22/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536129_A/New_York/13/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536100_A/Massachusetts/0      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535909_A/Massachusetts/0      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535834_A/California/14/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892704_A/Canada-ON/RV152      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229598877_A/Ohio/07/2009         VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396504_A/Ohio/07/2009         VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396494_A/Ohio/07/2009         VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892702_A/Canada-ON/RV152      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229783398_A/New_York/1682/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCDTTCQTPK 300
gi|237511819_A/Mexico/4108/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536049_A/Arizona/02/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536088_A/Indiana/09/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229484027_A/Canada-NS/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892700_A/Canada-NS/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229892710_A/Canada-NS/RV153      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511821_A/Mexico/4115/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511811_A/Mexico/4482/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511799_A/Mexico/4486/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511817_A/Mexico/4603/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|237511795_A/Mexico/4604/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229783367_A/Korea/01/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229783377_A/New_York/1669/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536022_A/Arizona/01/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536003_A/Kansas/02/2009       VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536121_A/Michigan/02/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229598896_A/Texas/15/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229609563_A/Catalonia/P154/      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 275
gi|229299521_A/Texas/04/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228860929_A/Netherlands/602      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229484029_A/Mexico/InDRE448      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535997_A/South_Carolina/      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHECNTTCQTPK 300
gi|229609557_A/Catalonia/P148/      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHECNTTCQTPK 276
gi|229299515_A/Texas/04/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229396467_A/Texas/06/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535816_A/Texas/09/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535985_A/Texas/08/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536075_A/Texas/07/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229368677_A/Denmark/513/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831826_A/Texas/04/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831774_A/Texas/05/2009        VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831776_A/California/06/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227831759_A/California/05/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227977104_A/California/10/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536135_A/Colorado/03/200      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228481046_A/Auckland/1/2009      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 258
gi|237624327_A/swine/Alberta/O      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229536010_A/Kansas/03/2009       VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228495370_A/Regensburg/Germ      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 260
gi|229892706A/Mexico/InDRE4114      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229535949_A/California/04/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227809830_A/California/04/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|229299517_A/California/07/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|228017758_A/California/08/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
gi|227977172_A/California/07/2      VEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK 300
                                    ****************************************:*:*******

gi|229396357_A/New_York/12/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892708_A/Canada-AB/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396399_A/New_York/18/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536064_A/New_York/20/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536055_A/New_York/20/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396487_A/New_York/19/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227977099_A/New_York/19/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396410_A/New_York/31/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396419_A/New_York/23/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396381_A/New_York/11/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396443_A/New_York/10/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229484031_A/Canada-ON/RV152      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535797_A/New_York/22/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536129_A/New_York/13/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536100_A/Massachusetts/0      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535909_A/Massachusetts/0      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535834_A/California/14/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892704_A/Canada-ON/RV152      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229598877_A/Ohio/07/2009         GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396504_A/Ohio/07/2009         GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396494_A/Ohio/07/2009         GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892702_A/Canada-ON/RV152      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229783398_A/New_York/1682/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511819_A/Mexico/4108/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536049_A/Arizona/02/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536088_A/Indiana/09/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229484027_A/Canada-NS/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892700_A/Canada-NS/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229892710_A/Canada-NS/RV153      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511821_A/Mexico/4115/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511811_A/Mexico/4482/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511799_A/Mexico/4486/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511817_A/Mexico/4603/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|237511795_A/Mexico/4604/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229783367_A/Korea/01/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229783377_A/New_York/1669/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536022_A/Arizona/01/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536003_A/Kansas/02/2009       GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536121_A/Michigan/02/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229598896_A/Texas/15/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229609563_A/Catalonia/P154/      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 325
gi|229299521_A/Texas/04/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|228860929_A/Netherlands/602      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229484029_A/Mexico/InDRE448      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535997_A/South_Carolina/      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229609557_A/Catalonia/P148/      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 326
gi|229299515_A/Texas/04/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229396467_A/Texas/06/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535816_A/Texas/09/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535985_A/Texas/08/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536075_A/Texas/07/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229368677_A/Denmark/513/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831826_A/Texas/04/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831774_A/Texas/05/2009        GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831776_A/California/06/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227831759_A/California/05/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|227977104_A/California/10/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536135_A/Colorado/03/200      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|228481046_A/Auckland/1/2009      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 308
gi|237624327_A/swine/Alberta/O      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229536010_A/Kansas/03/2009       GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|228495370_A/Regensburg/Germ      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 310
gi|229892706A/Mexico/InDRE4114      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAI 350
gi|229535949_A/California/04/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|227809830_A/California/04/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|229299517_A/California/07/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|228017758_A/California/08/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
gi|227977172_A/California/07/2      GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAI 350
                                    *************************************:************

gi|229396357_A/New_York/12/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229892708_A/Canada-AB/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396399_A/New_York/18/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536064_A/New_York/20/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536055_A/New_York/20/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396487_A/New_York/19/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227977099_A/New_York/19/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396410_A/New_York/31/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396419_A/New_York/23/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396381_A/New_York/11/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396443_A/New_York/10/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229484031_A/Canada-ON/RV152      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535797_A/New_York/22/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536129_A/New_York/13/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536100_A/Massachusetts/0      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535909_A/Massachusetts/0      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535834_A/California/14/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229892704_A/Canada-ON/RV152      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229598877_A/Ohio/07/2009         AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396504_A/Ohio/07/2009         AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396494_A/Ohio/07/2009         AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229892702_A/Canada-ON/RV152      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229783398_A/New_York/1682/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511819_A/Mexico/4108/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536049_A/Arizona/02/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536088_A/Indiana/09/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229484027_A/Canada-NS/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVV 400
gi|229892700_A/Canada-NS/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVV 400
gi|229892710_A/Canada-NS/RV153      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVV 400
gi|237511821_A/Mexico/4115/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511811_A/Mexico/4482/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511799_A/Mexico/4486/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511817_A/Mexico/4603/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|237511795_A/Mexico/4604/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229783367_A/Korea/01/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229783377_A/New_York/1669/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536022_A/Arizona/01/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536003_A/Kansas/02/2009       AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536121_A/Michigan/02/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229598896_A/Texas/15/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229609563_A/Catalonia/P154/      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 375
gi|229299521_A/Texas/04/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228860929_A/Netherlands/602      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229484029_A/Mexico/InDRE448      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535997_A/South_Carolina/      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229609557_A/Catalonia/P148/      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 376
gi|229299515_A/Texas/04/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229396467_A/Texas/06/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535816_A/Texas/09/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535985_A/Texas/08/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536075_A/Texas/07/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229368677_A/Denmark/513/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831826_A/Texas/04/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831774_A/Texas/05/2009        AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831776_A/California/06/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227831759_A/California/05/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227977104_A/California/10/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536135_A/Colorado/03/200      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228481046_A/Auckland/1/2009      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 358
gi|237624327_A/swine/Alberta/O      VGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229536010_A/Kansas/03/2009       AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228495370_A/Regensburg/Germ      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 360
gi|229892706A/Mexico/InDRE4114      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229535949_A/California/04/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227809830_A/California/04/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|229299517_A/California/07/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|228017758_A/California/08/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
gi|227977172_A/California/07/2      AGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVI 400
                                    .************************************************:

gi|229396357_A/New_York/12/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892708_A/Canada-AB/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396399_A/New_York/18/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536064_A/New_York/20/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536055_A/New_York/20/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396487_A/New_York/19/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227977099_A/New_York/19/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396410_A/New_York/31/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396419_A/New_York/23/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396381_A/New_York/11/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396443_A/New_York/10/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229484031_A/Canada-ON/RV152      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535797_A/New_York/22/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536129_A/New_York/13/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536100_A/Massachusetts/0      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535909_A/Massachusetts/0      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535834_A/California/14/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892704_A/Canada-ON/RV152      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229598877_A/Ohio/07/2009         EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229396504_A/Ohio/07/2009         EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229396494_A/Ohio/07/2009         EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229892702_A/Canada-ON/RV152      EKMNTQFTAVGKEFNHLEKRIENLNKKIDDGFLDIWTYNAELLVLLENER 450
gi|229783398_A/New_York/1682/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511819_A/Mexico/4108/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLILLENER 450
gi|229536049_A/Arizona/02/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536088_A/Indiana/09/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229484027_A/Canada-NS/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892700_A/Canada-NS/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229892710_A/Canada-NS/RV153      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511821_A/Mexico/4115/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511811_A/Mexico/4482/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511799_A/Mexico/4486/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511817_A/Mexico/4603/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|237511795_A/Mexico/4604/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229783367_A/Korea/01/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229783377_A/New_York/1669/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536022_A/Arizona/01/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536003_A/Kansas/02/2009       EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536121_A/Michigan/02/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229598896_A/Texas/15/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229609563_A/Catalonia/P154/      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 425
gi|229299521_A/Texas/04/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228860929_A/Netherlands/602      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229484029_A/Mexico/InDRE448      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535997_A/South_Carolina/      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229609557_A/Catalonia/P148/      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 426
gi|229299515_A/Texas/04/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229396467_A/Texas/06/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535816_A/Texas/09/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535985_A/Texas/08/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536075_A/Texas/07/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229368677_A/Denmark/513/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831826_A/Texas/04/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831774_A/Texas/05/2009        EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831776_A/California/06/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227831759_A/California/05/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227977104_A/California/10/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536135_A/Colorado/03/200      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228481046_A/Auckland/1/2009      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 408
gi|237624327_A/swine/Alberta/O      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229536010_A/Kansas/03/2009       EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228495370_A/Regensburg/Germ      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 410
gi|229892706A/Mexico/InDRE4114      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229535949_A/California/04/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227809830_A/California/04/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|229299517_A/California/07/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|228017758_A/California/08/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
gi|227977172_A/California/07/2      EKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER 450
                                    ***************************:***************:******

gi|229396357_A/New_York/12/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892708_A/Canada-AB/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396399_A/New_York/18/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536064_A/New_York/20/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536055_A/New_York/20/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396487_A/New_York/19/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227977099_A/New_York/19/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396410_A/New_York/31/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396419_A/New_York/23/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396381_A/New_York/11/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396443_A/New_York/10/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229484031_A/Canada-ON/RV152      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535797_A/New_York/22/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536129_A/New_York/13/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536100_A/Massachusetts/0      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535909_A/Massachusetts/0      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535834_A/California/14/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892704_A/Canada-ON/RV152      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229598877_A/Ohio/07/2009         TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396504_A/Ohio/07/2009         TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396494_A/Ohio/07/2009         TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892702_A/Canada-ON/RV152      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229783398_A/New_York/1682/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511819_A/Mexico/4108/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536049_A/Arizona/02/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536088_A/Indiana/09/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229484027_A/Canada-NS/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892700_A/Canada-NS/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229892710_A/Canada-NS/RV153      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511821_A/Mexico/4115/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511811_A/Mexico/4482/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511799_A/Mexico/4486/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511817_A/Mexico/4603/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|237511795_A/Mexico/4604/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229783367_A/Korea/01/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229783377_A/New_York/1669/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536022_A/Arizona/01/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536003_A/Kansas/02/2009       TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536121_A/Michigan/02/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229598896_A/Texas/15/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229609563_A/Catalonia/P154/      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 475
gi|229299521_A/Texas/04/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228860929_A/Netherlands/602      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229484029_A/Mexico/InDRE448      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535997_A/South_Carolina/      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229609557_A/Catalonia/P148/      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 476
gi|229299515_A/Texas/04/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229396467_A/Texas/06/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535816_A/Texas/09/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535985_A/Texas/08/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536075_A/Texas/07/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229368677_A/Denmark/513/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831826_A/Texas/04/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831774_A/Texas/05/2009        TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831776_A/California/06/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227831759_A/California/05/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227977104_A/California/10/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536135_A/Colorado/03/200      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228481046_A/Auckland/1/2009      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 458
gi|237624327_A/swine/Alberta/O      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229536010_A/Kansas/03/2009       TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228495370_A/Regensburg/Germ      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 460
gi|229892706A/Mexico/InDRE4114      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229535949_A/California/04/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227809830_A/California/04/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|229299517_A/California/07/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|228017758_A/California/08/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
gi|227977172_A/California/07/2      TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT 500
                                    **************************************************

gi|229396357_A/New_York/12/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892708_A/Canada-AB/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396399_A/New_York/18/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536064_A/New_York/20/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536055_A/New_York/20/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396487_A/New_York/19/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227977099_A/New_York/19/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396410_A/New_York/31/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396419_A/New_York/23/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396381_A/New_York/11/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396443_A/New_York/10/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229484031_A/Canada-ON/RV152      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535797_A/New_York/22/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536129_A/New_York/13/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536100_A/Massachusetts/0      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535909_A/Massachusetts/0      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535834_A/California/14/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892704_A/Canada-ON/RV152      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229598877_A/Ohio/07/2009         YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396504_A/Ohio/07/2009         YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396494_A/Ohio/07/2009         YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892702_A/Canada-ON/RV152      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229783398_A/New_York/1682/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511819_A/Mexico/4108/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536049_A/Arizona/02/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536088_A/Indiana/09/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229484027_A/Canada-NS/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892700_A/Canada-NS/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229892710_A/Canada-NS/RV153      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511821_A/Mexico/4115/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511811_A/Mexico/4482/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511799_A/Mexico/4486/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511817_A/Mexico/4603/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|237511795_A/Mexico/4604/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229783367_A/Korea/01/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229783377_A/New_York/1669/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536022_A/Arizona/01/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536003_A/Kansas/02/2009       YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536121_A/Michigan/02/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229598896_A/Texas/15/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229609563_A/Catalonia/P154/      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 525
gi|229299521_A/Texas/04/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228860929_A/Netherlands/602      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229484029_A/Mexico/InDRE448      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535997_A/South_Carolina/      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229609557_A/Catalonia/P148/      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 526
gi|229299515_A/Texas/04/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229396467_A/Texas/06/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535816_A/Texas/09/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229535985_A/Texas/08/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536075_A/Texas/07/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229368677_A/Denmark/513/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831826_A/Texas/04/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831774_A/Texas/05/2009        YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831776_A/California/06/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227831759_A/California/05/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227977104_A/California/10/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536135_A/Colorado/03/200      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228481046_A/Auckland/1/2009      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 508
gi|237624327_A/swine/Alberta/O      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229536010_A/Kansas/03/2009       YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228495370_A/Regensburg/Germ      YDYPKYSEEAKLNREEIDGVK----------------------------- 481
gi|229892706A/Mexico/InDRE4114      YDYPKYSEEAKLNREEIDGVKLESTRFYQILAIYSTVASSLVLVVSLGAI 550
gi|229535949_A/California/04/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227809830_A/California/04/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|229299517_A/California/07/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|228017758_A/California/08/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
gi|227977172_A/California/07/2      YDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAI 550
                                    *********************                             

gi|229396357_A/New_York/12/200      SFWMCSNGSLQCRICI 566
gi|229892708_A/Canada-AB/RV153      SFWMCSNGSLQCRICI 566
gi|229396399_A/New_York/18/200      SFWMCSNGSLQCRICI 566
gi|229536064_A/New_York/20/200      SFWMCSNGSLQCRICI 566
gi|229536055_A/New_York/20/200      SFWMCSNGSLQCRICI 566
gi|229396487_A/New_York/19/200      SFWMCSNGSLQCRICI 566
gi|227977099_A/New_York/19/200      SFWMCSNGSLQCRICI 566
gi|229396410_A/New_York/31/200      SFWMCSNGSLQCRICI 566
gi|229396419_A/New_York/23/200      SFWMCSNGSLQCRICI 566
gi|229396381_A/New_York/11/200      SFWMCSNGSLQCRICI 566
gi|229396443_A/New_York/10/200      SFWMCSNGSLQCRICI 566
gi|229484031_A/Canada-ON/RV152      SFWMCSNGSLQCRICI 566
gi|229535797_A/New_York/22/200      SFWMCSNGSLQCRICI 566
gi|229536129_A/New_York/13/200      SFWMCSNGSLQCRICI 566
gi|229536100_A/Massachusetts/0      SFWMCSNGSLQCRICI 566
gi|229535909_A/Massachusetts/0      SFWMCSNGSLQCRICI 566
gi|229535834_A/California/14/2      SFWMCSNGSLQCRICI 566
gi|229892704_A/Canada-ON/RV152      SFWMCSNGSLQCRICI 566
gi|229598877_A/Ohio/07/2009         SFWMCSNGSLQCRICI 566
gi|229396504_A/Ohio/07/2009         SFWMCSNGSLQCRICI 566
gi|229396494_A/Ohio/07/2009         SFWMCSNGSLQCRICI 566
gi|229892702_A/Canada-ON/RV152      SFWMCSNGSLQCRICI 566
gi|229783398_A/New_York/1682/2      SFWMCSNGSLQCRICI 566
gi|237511819_A/Mexico/4108/200      SFWMCSNGSLQCRICI 566
gi|229536049_A/Arizona/02/2009      SFWMCSNGSLQCRICI 566
gi|229536088_A/Indiana/09/2009      SFWMCSNGSLQCRICI 566
gi|229484027_A/Canada-NS/RV153      SFWMCSNGSLQCRICI 566
gi|229892700_A/Canada-NS/RV153      SFWMCSNGSLQCRICI 566
gi|229892710_A/Canada-NS/RV153      SFWMCSNGSLQCRICI 566
gi|237511821_A/Mexico/4115/200      SFWMCSNGSLQCRICI 566
gi|237511811_A/Mexico/4482/200      SFWMCSNGSLQCRICI 566
gi|237511799_A/Mexico/4486/200      SFWMCSNGSLQCRICI 566
gi|237511817_A/Mexico/4603/200      SFWMCSNGSLQCRICI 566
gi|237511795_A/Mexico/4604/200      SFWMCSNGSLQCRICI 566
gi|229783367_A/Korea/01/2009        SFWMCSNGSLQCRICI 566
gi|229783377_A/New_York/1669/2      SFWMCSNGSLQCRICI 566
gi|229536022_A/Arizona/01/2009      SFWMCSNGSLQCRICI 566
gi|229536003_A/Kansas/02/2009       SFWMCSNGSLQCRICI 566
gi|229536121_A/Michigan/02/200      SFWMCSNGSLQCRICI 566
gi|229598896_A/Texas/15/2009        SFWMCSNGSLQCRICI 566
gi|229609563_A/Catalonia/P154/      SFWMCSNG-------- 533
gi|229299521_A/Texas/04/2009        SFWMCSNGSLQCRICI 566
gi|228860929_A/Netherlands/602      SFWMCSNGSLQCRICI 566
gi|229484029_A/Mexico/InDRE448      SFWMCSNGSLQCRICI 566
gi|229535997_A/South_Carolina/      SFWMCSNGSLQCRICI 566
gi|229609557_A/Catalonia/P148/      SFWMCSNG-------- 534
gi|229299515_A/Texas/04/2009        SFWMCSNGSLQCRICI 566
gi|229396467_A/Texas/06/2009        SFWMCSNGSLQCRICI 566
gi|229535816_A/Texas/09/2009        SFWMCSNGSLQCRICI 566
gi|229535985_A/Texas/08/2009        SFWMCSNGSLQCRICI 566
gi|229536075_A/Texas/07/2009        SFWMCSNGSLQCRICI 566
gi|229368677_A/Denmark/513/200      SFWMCSNGSLQCRICI 566
gi|227831826_A/Texas/04/2009        SFWMCSNGSLQCRICI 566
gi|227831774_A/Texas/05/2009        SFWMCSNGSLQCRICI 566
gi|227831776_A/California/06/2      SFWMCSNGSLQCRICI 566
gi|227831759_A/California/05/2      SFWMCSNGSLQCRICI 566
gi|227977104_A/California/10/2      SFWMCSNGSLQCRICI 566
gi|229536135_A/Colorado/03/200      SFWMCSNGSLQCRICI 566
gi|228481046_A/Auckland/1/2009      SFWMCSNGSLQCRICI 524
gi|237624327_A/swine/Alberta/O      SFWMCSNGSLQCRICI 566
gi|229536010_A/Kansas/03/2009       SFWMCSNGSLQCRICI 566
gi|228495370_A/Regensburg/Germ      ----------------
gi|229892706A/Mexico/InDRE4114      SFWMCSNGSLQCRICI 566
gi|229535949_A/California/04/2      SFWMCSNGSLQCRICI 566
gi|227809830_A/California/04/2      SFWMCSNGSLQCRICI 566
gi|229299517_A/California/07/2      SFWMCSNGSLQCRICI 566
gi|228017758_A/California/08/2      SFWMCSNGSLQCRICI 566
gi|227977172_A/California/07/2      SFWMCSNGSLQCRICI 566

Proteopedia Page Contributors and Editors (what is this?)

Michael Strong

Personal tools